KEGG   Escherichia coli K-12 MG1655: b1114Help
Entry
b1114             CDS       T00007                                 

Gene name
mfd
Definition
(RefSeq) transcription-repair coupling factor
  KO
K03723  
transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    b1114 (mfd)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     b1114 (mfd)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      b1114 (mfd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1170518..1173964)
Genome map
AA seq 1148 aa AA seqDB search
MPEQYRYTLPVKAGEQRLLGELTGAACATLVAEIAERHAGPVVLIAPDMQNALRLHDEIS
QFTDQMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLPTMQRGVLIVPVNTLMQRVCPH
SFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYATRGALLDLFPMGSELPY
RLDFFDDEIDSLRVFDVDSQRTLEEVEAINLLPAHEFPTDKAAIELFRSQWRDTFEVKRD
PEHIYQQVSKGTLPAGIEYWQPLFFSEPLPPLFSYFPANTLLVNTGDLETSAERFQADTL
ARFENRGVDPMRPLLPPQSLWLRVDELFSELKNWPRVQLKTEHLPTKAANANLGFQKLPD
LAVQAQQKAPLDALRKFLETFDGPVVFSVESEGRREALGELLARIKIAPQRIMRLDEASD
RGRYLMIGAAEHGFVDTVRNLALICESDLLGERVARRRQDSRRTINPDTLIRNLAELHIG
QPVVHLEHGVGRYAGMTTLEAGGITGEYLMLTYANDAKLYVPVSSLHLISRYAGGAEENA
PLHKLGGDAWSRARQKAAEKVRDVAAELLDIYAQRAAKEGFAFKHDREQYQLFCDSFPFE
TTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTL
LAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKF
KDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIATPP
ARRLAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLAELVPEARIAI
GHGQMRERELERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLR
GRVGRSHHQAYAWLLTPHPKAMTTDAQKRLEAIASLEDLGAGFALATHDLEIRGAGELLG
EEQSGSMETIGFSLYMELLENAVDALKAGREPSLEDLTSQQTEVELRMPSLLPDDFIPDV
NTRLSFYKRIASAKTENELEEIKVELIDRFGLLPDPARTLLDIARLRQQAQKLGIRKLEG
NEKGGVIEFAEKNHVNPAWLIGLLQKQPQHYRLDGPTRLKFIQDLSERKTRIEWVRQFMR
ELEENAIA
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacaatatcgttatacgctgcccgtcaaagcgggtgagcagcgtctgctgggc
gagttaaccggcgcagcctgtgcaacgctggtagcggaaattgccgaacgtcacgccggt
ccggtggtactcattgcaccagatatgcaaaatgctctgcgtttgcatgatgaaatcagc
cagtttaccgatcaaatggtgatgaatctggcggactgggaaactcttccctacgacagt
ttttcgcctcatcaggacattatctcctcgcgcctttccaccctttaccagctaccgacg
atgcagcgtggcgtactgattgttccggtgaatacgcttatgcagcgcgtttgcccacac
agttttctccacggtcatgcgctggtgatgaaaaaaggtcagcgcctgtcacgagatgca
ttacgaacccaactggacagcgccggttatcgccatgttgaccaggtgatggagcacggc
gaatacgccacgcgcggcgcgttgctggatctcttcccgatggggagtgagctgccttat
cgtcttgatttctttgatgatgaaatcgacagcctgcgggtgtttgacgtcgacagccag
cgcacgctggaggaagtagaagcgatcaatctgctgcccgcgcacgaatttccgaccgat
aaagcggcaattgaactgttccgcagccagtggcgcgataccttcgaagtgaagcgcgat
ccagaacatatttaccagcaagtgagtaaaggcacattacctgccgggatcgagtactgg
cagccattgttcttcagcgaaccactgccgccgctgttcagttatttccctgccaatacc
ttgctcgtgaatactggcgatctggaaaccagtgccgaacgtttccaggctgacacgctg
gcgcgttttgagaatcgcggcgtcgatccgatgcgcccgctgttgccaccacaatcgctc
tggctgcgggtggacgagctcttctcagagctgaaaaactggccccgggtgcagctaaaa
actgaacatttaccgacaaaagccgcgaatgccaatttaggtttccagaaactgccagac
ctggccgttcaggcacaacaaaaagcgccgctggatgcgctgcgtaagttcctcgagact
ttcgacggtccggtggtgttctcggtagaaagtgaaggtcgccgtgaagcgctgggtgaa
ctgctcgcacgaattaaaattgctccgcaacgcattatgcgtcttgatgaagccagcgac
cgtgggcgttatctgatgattggcgctgccgaacatggttttgtcgatacggtgcgtaat
ctggcgctgatttgcgaaagcgatctgctcggtgaacgcgttgcccgtcgtcgtcaggat
tctcgccgcaccatcaaccccgatacactgatccgtaaccttgcggaactgcatattggt
cagccggtggtccatctggagcacggcgtcggtcgttatgccggaatgaccacgctggaa
gcgggtggcattactggcgagtatctgatgctcacctatgccaacgacgccaaactgtat
gttccggtgtcgtcactgcatctgattagccgttacgcaggtggcgcggaagaaaacgcc
ccgctgcataaacttggcggcgatgcgtggtcacgcgcgcggcagaaagcggcggaaaaa
gtgcgtgatgtggcggcggaattgctggatatctacgcgcaacgcgccgccaaagagggc
ttcgcgtttaaacacgatcgtgagcagtatcagttgttctgcgacagcttcccgtttgaa
accacgccggatcaggcgcaggccattaatgcggtacttagcgacatgtgtcagccgctg
gcaatggatcgtctggtgtgcggcgatgttggctttggtaaaacagaagtggcgatgcgc
gcagctttcctggcagtagataaccacaagcaggtggcggtgctggtgcctaccaccctt
ctcgcgcagcagcattacgacaacttccgcgaccgtttcgccaactggccggtacgtatc
gaaatgatctcccgtttccgcagcgccaaagagcagacgcaaatccttgcggaagtggcg
gaagggaaaatcgatattctgatcggtacgcacaaactgctgcaaagtgacgtcaagttt
aaagatttaggcctgctgattgtcgatgaagaacaccgcttcggggtgcgtcataaagag
cgcattaaagcgatgcgcgcgaacgtggatattctgacgcttactgcaacgccgatccca
cgtacgctgaatatggcaatgagcggaatgcgtgacctgtcgattatcgccacgccgccc
gcccgtcgtctggcagttaaaacctttgtccgtgagtatgacagcatggtggtccgggag
gcgatcctgcgtgaaattttgcgcggaggacaggtttattatctctacaatgatgtggaa
aacattcagaaagccgccgaacggctggcagaactggtgccagaagcgcggatcgccatc
ggtcacgggcagatgcgcgagcgcgaactggaacgggtgatgaatgatttccatcatcaa
cgtttcaacgtgctggtttgtacaaccattatcgaaaccgggatcgacatcccgacagcc
aacactattatcattgaacgcgcggatcacttcggtctggcgcagctgcaccagttacgc
ggtcgcgtcggacgttcgcatcatcaggcatatgcatggttgctgacaccgcatccaaaa
gcgatgactaccgatgcacaaaaacgtcttgaagcaattgcctcgctggaagatctcggg
gcaggttttgcgctggcaacgcacgatctggagattcgcggcgcgggtgaactgcttggc
gaagaacaaagcggctcaatggaaaccatcggtttctcgctgtatatggagttgctggaa
aacgccgtcgatgcactgaaagccggacgcgagccgtcgctggaagatctcaccagccag
caaacagaagtcgagctgcggatgccgtcgctattgccagatgatttcatccctgacgtg
aacacgcgtctgtcgttctacaaacgtattgccagcgccaaaacggaaaacgaactggaa
gagatcaaagtcgagcttatcgatcgcttcggcctgctgccagatccggcgcgtaccctg
ctggatattgcccgtctgcgccagcaagcgcagaaactggggatcaggaagctggaaggt
aatgagaaaggcggggtgatcgaatttgccgagaagaatcacgttaatccggcctggttg
attggtttgctgcaaaaacagccgcagcattaccgccttgatggtccgacgcgcctgaaa
tttattcaggatttgagtgagcggaaaacgcgtatcgaatgggtacgccagtttatgcgt
gaactggaagagaacgcgatcgcttaa

DBGET integrated database retrieval system