KEGG   Escherichia coli K-12 MG1655: b1117Help
Entry
b1117             CDS       T00007                                 

Gene name
lolD
Definition
(RefSeq) outer membrane-specific lipoprotein transporter subunit
  KO
K09810  
lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b1117 (lolD)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     b1117 (lolD)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    b1117 (lolD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1176619..1177320
Genome map
AA seq 233 aa AA seqDB search
MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDT
PTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPA
EINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARN
ADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAE
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatcctgttgcaatgcgacaacctgtgcaaacgctatcaggaaggcagtgtg
caaaccgatgtgctgcacaatgtcagtttcagcgtcggcgaaggtgaaatgatggcgatc
gtcggtagctctggttccggtaaaagtaccttgctgcacctgctgggcgggctggatacg
ccaacctccggcgatgtgatttttaatggtcagccaatgagcaaactgtcgtcggcagcg
aaagctgaactgcgcaaccagaagctgggctttatttatcagtttcaccacctgctgccg
gattttaccgccctggaaaacgtggctatgccgctgctgattggcaagaaaaagcccgct
gaaatcaacagccgtgcacttgagatgttaaaagcggtggggctggatcatcgtgcgaat
caccgcccatctgaactttctggcggcgaacgccagcgtgtggcgattgcccgtgcgctg
gtgaataacccgcgcctggtactggcggatgaacctaccggtaacctcgatgcgcgtaac
gccgacagcatcttccagttgcttggggaattgaatcgcttgcagggcaccgccttcctg
gtggttactcacgacctgcaactggcgaaacgtatgagccgccagttagaaatgcgtgat
ggtcgtctgacggcggaactgagcctgatgggggcggagtaa

DBGET integrated database retrieval system