KEGG   Escherichia coli K-12 MG1655: b1118Help
Entry
b1118             CDS       T00007                                 

Gene name
lolE
Definition
(RefSeq) lipoprotein-releasing system transmembrane protein
  KO
K09808  
lipoprotein-releasing system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b1118 (lolE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    b1118 (lolE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1177320..1178564
Genome map
AA seq 414 aa AA seqDB search
MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRIL
AVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNP
QQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLM
QPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRD
AGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSG
DIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQF
LSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgcctttatcgttattaattggcctgcgttttagtcgcggacggcggcgcggc
ggcatggtgtcgctgatctccgttatttctaccattggcattgccctcggcgtggcggta
ttgatcgtcggcttaagcgcgatgaacggctttgaacgcgaactgaacaaccgtattctg
gcggtggtgccgcatggtgaaatcgaggcggtggatcagccgtggactaactggcaggaa
gcactggatcacgtgcaaaaagtgccgggtattgccgctgccgcgccgtatatcaatttc
accgggctggtggaaagtggcgcgaatcttcgcgcaatccaggtgaagggcgttaacccg
caacaggaacagcgtctgagcgcattaccctcgtttgtccagggcgatgcgtggcgcaat
tttaaagcgggcgaacagcaaattatcatcggcaaaggcgtggcggatgcgctgaaagtg
aagcagggggattgggtgtcgattatgatccccaactcgaatcccgagcataaactgatg
cagccaaaacgtgtgcgtttgcacgttgccggtattttgcagttgagtggtcaactcgat
cacagttttgccatgatcccgctggcggatgcccaacaatatcttgatatgggttccagc
gtgtcaggtattgcccttaaaatgacggatgttttcaacgccaataagctggtacgcgat
gcgggtgaagtgaccaacagctatgtttatattaaaagctggattggtacttacggctat
atgtatcgcgatatccaaatgatccgcgccattatgtatctggcgatggtactggtgatt
ggcgtggcctgtttcaacatcgtctccaccttagtgatggcggtgaaagacaagagtggc
gatatcgcagtattaagaacgctgggggcgaaagatggtttaattcgcgccatctttgtc
tggtatggattgctggcagggctgttcggcagcctgtgtggtgtgattatcggcgtagtg
gtttcactgcaacttaccccgattattgagtggattgaaaagttgatcggtcatcagttc
ctctccagcgatatctattttattgatttcctgccatcggaattgcactggctggacgtc
ttctacgtactggtcacagcattgttgctgagtcttttggcaagttggtatccggcgcgg
cgcgccagtaatattgaccctgcgcgagtccttagcggccagtaa

DBGET integrated database retrieval system