KEGG   Escherichia coli K-12 MG1655: b1124Help
Entry
b1124             CDS       T00007                                 

Gene name
potC
Definition
(RefSeq) spermidine/putrescine ABC transporter permease
  KO
K11070  
spermidine/putrescine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b1124 (potC)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299] [OT]
    b1124 (potC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1182826..1183620)
Genome map
AA seq 264 aa AA seqDB search
MIGRLLRGGFMTAIYAYLYIPIIILIVNSFNSSRFGINWQGFTTKWYSLLMNNDSLLQAA
QHSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFM
LLGIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL
AMPAVAAGWVLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILLVL
SLVMVIASQLIARDKTKGNTGDVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgactgcttcgcggcggttttatgaccgctatctacgcgtacctgtatatc
ccaatcattattttgattgtgaactcctttaacagctcgcgctttggcatcaactggcag
ggctttaccaccaaatggtatagcctgctgatgaacaacgacagcctgttacaggcagcg
cagcattcactaacaatggcggtgttttcggcgacgtttgctacgcttatcggttcactg
acggcagttgcgctgtaccgttatcgctttcgtggtaagccgttcgttagcggaatgctg
tttgtggtgatgatgtcaccagatatcgtgatggcgatttcgctgctggtgctgtttatg
ctgctgggtattcagcttggcttctggtcgctgctgttctcgcatatcaccttctgcctg
ccatttgtggtggtgacggtgtattcgcgcctgaaaggttttgacgtgcgaatgctggaa
gcggcgaaagatctcggtgccagcgaatttaccattctgcgaaaaatcattctgccactg
gcaatgccagcggtggcggcgggctgggtgttaagctttaccctgtcgatggacgatgtg
gtagtttcttcgttcgtcaccggaccaagttatgaaattctgccgttaaaaatttattcg
atggtcaaagtcggcgtatcgccggaagttaacgcgctggcaaccatattactggtgctg
tcgctggtgatggttattgccagccagcttattgctcgtgataaaacgaaaggtaacaca
ggggacgttaaatga

DBGET integrated database retrieval system