KEGG   Escherichia coli K-12 MG1655: b1130Help
Entry
b1130             CDS       T00007                                 

Gene name
phoP
Definition
(RefSeq) response regulator in two-component regulatory system with PhoQ
  KO
K07660  
two-component system, OmpR family, response regulator PhoP
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Module
PhoQ-PhoP (magnesium transport) two-component regulatory system
Macrolide resistance, MacAB-TolC transporter
Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
Cationic antimicrobial peptide (CAMP) resistance, phosphoethanolamine transferase EptB
Cationic antimicrobial peptide (CAMP) resistance, palmitoyl transferase PagP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1130 (phoP)
 Human Diseases
  Antimicrobial resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b1130 (phoP)
Two-component system [BR:eco02022]
 OmpR family
  PhoQ-PhoP [MD:M00444]
   b1130 (phoP)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    b1130 (phoP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1189776..1190447)
Genome map
AA seq 223 aa AA seqDB search
MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHIPDIAIVDLGLPDEDGL
SLIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNS
GLASQVISLPPFQVDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYP
DAELRESHTIDVLMGRLRKKIQAQYPQEVITTVRGQGYLFELR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtactggttgttgaagacaatgcgttgttacgtcaccaccttaaagttcagatt
caggatgctggtcatcaggtcgatgacgcagaagatgccaaagaagccgattattatctc
aatgaacatataccggatattgcgattgtcgatctcggattgccagacgaggacggtctg
tcactgattcgccgctggcgtagcaacgatgtttcactgccgattctggtattaaccgcc
cgtgaaagctggcaggacaaagtcgaagtattaagtgccggtgctgatgattatgtgact
aaaccgtttcatattgaagaggtgatggcgcgaatgcaggcattaatgcggcgtaatagc
ggtctggcttcacaggtcatttcgctccccccgtttcaggttgatctctctcgccgtgaa
ttatctattaatgacgaagtgatcaaactgaccgcgttcgaatacactattatggaaacg
ttgatacgcaataatggcaaagtggtcagcaaagattcgttaatgctccaactctatccg
gatgcggagctgcgggaaagccataccattgatgtactgatgggacgtctgcgcaaaaaa
attcaggcacaatatccccaagaagtgattaccaccgttcgcggccagggctatctgttc
gaattgcgctga

DBGET integrated database retrieval system