KEGG   Escherichia coli K-12 MG1655: b1136Help
Entry
b1136             CDS       T00007                                 

Gene name
icd
Definition
(RefSeq) e14 prophage; isocitrate dehydrogenase, specific for NADP+ (EC:1.1.1.42)
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b1136 (icd)
   01210 2-Oxocarboxylic acid metabolism
    b1136 (icd)
   01230 Biosynthesis of amino acids
    b1136 (icd)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    b1136 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    b1136 (icd)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     b1136 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1195123..1196373
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMDGAKLLKCSEFGDAIIENM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtagttgttccggcacaaggcaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgaaaatccgattatcccttacattgaaggtgatggaatcggtgtagat
gtaaccccagccatgctgaaagtggtcgacgctgcagtcgagaaagcctataaaggcgag
cgtaaaatctcctggatggaaatttacaccggtgaaaaatccacacaggtttatggtcag
gacgtctggctgcctgctgaaactcttgatctgattcgtgaatatcgcgttgccattaaa
ggtccgctgaccactccggttggtggcggtattcgctctctgaacgttgccctgcgccag
gaactggatctctacatctgcctgcgtccggtacgttactatcagggcactccaagcccg
gttaaacaccctgaactgaccgatatggttatcttccgtgaaaactcggaagacatttat
gcgggtatcgaatggaaagcagactctgccgacgccgagaaagtgattaaattcctgcgt
gaagagatgggggtgaagaaaattcgcttcccggaacattgtggtatcggtattaagccg
tgttcggaagaaggcaccaaacgtctggttcgtgcagcgatcgaatacgcaattgctaac
gatcgtgactctgtgactctggtgcacaaaggcaacatcatgaagttcaccgaaggagcg
tttaaagactggggctaccagctggcgcgtgaagagtttggcggtgaactgatcgacggt
ggcccgtggctgaaagttaaaaacccgaacactggcaaagagatcgtcattaaagacgtg
attgctgatgcattcctgcaacagatcctgctgcgtccggctgaatatgatgttatcgcc
tgtatgaacctgaacggtgactacatttctgacgccctggcagcgcaggttggcggtatc
ggtatcgcccctggtgcaaacatcggtgacgaatgcgccctgtttgaagccacccacggt
actgcgccgaaatatgccggtcaggacaaagtaaatcctggctctattattctctccgct
gagatgatgctgcgccacatgggttggaccgaagcggctgacttaattgttaaaggtatg
gaaggcgcaatcaacgcgaaaaccgtaacctatgacttcgagcgtctgatggatggcgct
aaactgctgaaatgttcagagtttggtgacgcgatcatcgaaaacatgtaa

DBGET integrated database retrieval system