KEGG   Escherichia coli K-12 MG1655: b1136Help
Entry
b1136             CDS       T00007                                 

Gene name
icd
Definition
(RefSeq) isocitrate dehydrogenase; e14 prophage attachment site; tellurite reductase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    b1136 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    b1136 (icd)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     b1136 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1195123..1196373
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMDGAKLLKCSEFGDAIIENM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtagttgttccggcacaaggcaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgaaaatccgattatcccttacattgaaggtgatggaatcggtgtagat
gtaaccccagccatgctgaaagtggtcgacgctgcagtcgagaaagcctataaaggcgag
cgtaaaatctcctggatggaaatttacaccggtgaaaaatccacacaggtttatggtcag
gacgtctggctgcctgctgaaactcttgatctgattcgtgaatatcgcgttgccattaaa
ggtccgctgaccactccggttggtggcggtattcgctctctgaacgttgccctgcgccag
gaactggatctctacatctgcctgcgtccggtacgttactatcagggcactccaagcccg
gttaaacaccctgaactgaccgatatggttatcttccgtgaaaactcggaagacatttat
gcgggtatcgaatggaaagcagactctgccgacgccgagaaagtgattaaattcctgcgt
gaagagatgggggtgaagaaaattcgcttcccggaacattgtggtatcggtattaagccg
tgttcggaagaaggcaccaaacgtctggttcgtgcagcgatcgaatacgcaattgctaac
gatcgtgactctgtgactctggtgcacaaaggcaacatcatgaagttcaccgaaggagcg
tttaaagactggggctaccagctggcgcgtgaagagtttggcggtgaactgatcgacggt
ggcccgtggctgaaagttaaaaacccgaacactggcaaagagatcgtcattaaagacgtg
attgctgatgcattcctgcaacagatcctgctgcgtccggctgaatatgatgttatcgcc
tgtatgaacctgaacggtgactacatttctgacgccctggcagcgcaggttggcggtatc
ggtatcgcccctggtgcaaacatcggtgacgaatgcgccctgtttgaagccacccacggt
actgcgccgaaatatgccggtcaggacaaagtaaatcctggctctattattctctccgct
gagatgatgctgcgccacatgggttggaccgaagcggctgacttaattgttaaaggtatg
gaaggcgcaatcaacgcgaaaaccgtaacctatgacttcgagcgtctgatggatggcgct
aaactgctgaaatgttcagagtttggtgacgcgatcatcgaaaacatgtaa

DBGET integrated database retrieval system