KEGG   Escherichia coli K-12 MG1655: b1185Help
Entry
b1185             CDS       T00007                                 

Gene name
dsbB
Definition
(RefSeq) oxidoreductase that catalyzes reoxidation of DsbA protein disulfide isomerase I
  KO
K03611  
disulfide bond formation protein DsbB
Organism
eco  Escherichia coli K-12 MG1655
Brite
Chaperones and folding catalysts [BR:eco03110]
 Protein folding catalysts
  Protein disulfide isomerase
   b1185 (dsbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1232500..1233030)
Genome map
AA seq 176 aa AA seqDB search
MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI
GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWV
PQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgatttttgaaccaatgttcacaaggccggggcgcgtggctgttgatggcgttt
actgctctggcactggaactgacggcgctgtggttccagcatgtgatgttactgaaacct
tgcgtgctctgtatttatgaacgctgcgcgttattcggcgttctgggtgctgcgctgatt
ggcgcgatcgccccgaaaactccgctgcgttatgtagcgatggttatctggttgtatagt
gcgttccgcggtgtgcagttaacttacgagcacaccatgcttcagctctatccttcgccg
tttgccacctgtgattttatggttcgtttcccggaatggctgccgctggataagtgggtg
ccgcaagtgtttgtcgcctctggcgattgcgccgagcgtcagtgggattttttaggtctg
gaaatgccgcagtggctgctcggtatttttatcgcttacctgattgtcgcagtgctggtg
gtgatttcccagccgtttaaagcgaaaaaacgtgatctgttcggtcgctaa

DBGET integrated database retrieval system