KEGG   Escherichia coli K-12 MG1655: b1186Help
Entry
b1186             CDS       T00007                                 

Gene name
nhaB
Definition
(RefSeq) sodium:proton antiporter
  KO
K03314  
Na+:H+ antiporter, NhaB family
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1186 (nhaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1233176..1234717)
Genome map
AA seq 513 aa AA seqDB search
MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIFLISPFVAGWLLVAEFIFTLAMALK
CYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFTRL
LLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSRTEDTDLQD
DSHIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAAGWHFGDFFL
RMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQRTRQDKIRLI
VQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESLPFTALLTVF
FSVVAVIIDQQLFSPIIQFVLQASEHAQLSLFYIFNGLLSSISDNVFVGTIYINEAKAAM
ESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLSYGRMVWMALP
YTLVLTLVGLLCVEFTLAPVTEWFMQMGWIATL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggagatctcctggggccgcgcgctatggcgcaattttttgggccagtcccccgactgg
tacaaactcgccctcatcattttcttaatcgtaaacccgttaattttcctcatcagccct
ttcgtcgcgggctggttgctggtagcggaatttattttcactctggcgatggccctgaaa
tgctacccgctgctccccggtggtctgttggctatcgaagcggtattcatcggcatgacc
agcgcggaacacgtccgtgaagaggtggcggcaaatcttgaagtcttgctgttactgatg
tttatggtggcgggtatctattttatgaaacagctgttgctgttcatatttacccgtttg
ctgttaagcattcgctccaaaatgctgctgtcgctctctttttgcgtggcggctgcgttc
ctctccgcgttcctcgatgccttaaccgtcgtggcggtggtgatcagcgttgcagtcggt
ttttatggtatttatcaccgcgtagcctcttcccgtaccgaagacaccgacctgcaagac
gatagtcatatcgacaagcattacaaagtggttctggaacagttccgtggctttctgcgt
agcctgatgatgcatgccggtgtcggcaccgcattaggcggcgtaatgaccatggtgggc
gaaccacagaacctgatcatcgctaaagcggctggctggcattttggcgatttcttcctg
cgcatgtcgccggtgaccgttccggttctgatttgtggcctgttaacctgcctgctggta
gagaagctgcgttggtttggctacggtgaaacgctgccggagaaagtccgcgaagtgttg
caacagtttgacgatcaaagccgccaccagcgtacccgtcaggataaaatccgtctgatt
gtccaggcgattattggcgtctggctggtgactgcgctggcgttgcatctggcggaagtt
ggcttgattggtttgtcagtcattattctggcaacatcattgaccggtgtcaccgatgag
catgctatcggtaaagccttcaccgaatctctgccattcaccgcactgttgacggtgttt
ttctcggtagtcgcggtgattatcgaccaacaactgttttcgccaattattcagtttgtg
ttgcaggcatcggaacatgctcagctgtcgctgttctatattttcaacggtctgctgtca
tccatttcggataacgtcttcgtggggacgatttatatcaacgaagcgaaagcggcaatg
gaaagtggcgctatcacgttgaagcaatacgagctgctggcggtcgccattaataccggt
accaatctgccctccgtcgctacgccgaacggtcaggctgcgttcctgttcctgctgacc
tctgcactcgcgccattgattcgcctctcttatggccgcatggtgtggatggccctgcct
tacaccctcgtcctgacactcgtcggcttgctctgcgtcgagtttacgcttgcccctgta
accgaatggtttatgcaaatgggctggatagcaacgctttga

DBGET integrated database retrieval system