KEGG   Escherichia coli K-12 MG1655: b1208Help
Entry
b1208             CDS       T00007                                 

Gene name
ispE
Definition
(RefSeq) 4-diphosphocytidyl-2-C-methylerythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00900  Terpenoid backbone biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
Module
eco_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    b1208 (ispE)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     b1208 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 945774
NCBI-ProteinID: NP_415726
Pasteur: ychB
RegulonDB: ECK120001267
ECOCYC: EG11294
ASAP: ABE-0004056
UniProt: P62615
Structure
PDB: 

Jmol
Position
complement(1262026..1262877)
Genome map
AA seq 283 aa AA seqDB search
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVAKGANLSPLHRAML
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacagtggccctctccggcaaaacttaatctgtttttatacattaccggtcag
cgtgcggatggttaccacacgctgcaaacgctgtttcagtttcttgattacggcgacacc
atcagcattgagcttcgtgacgatggggatattcgtctgttaacgcccgttgaaggcgtg
gaacatgaagataacctgatcgttcgcgcagcgcgattgttgatgaaaactgcggcagac
agcgggcgtcttccgacgggaagcggtgcgaatatcagcattgacaagcgtttgccgatg
ggcggcggtctcggcggtggttcatccaatgccgcgacggtcctggtggcattaaatcat
ctctggcaatgcgggctaagcatggatgagctggcggaaatggggctgacgctgggcgca
gatgttcctgtctttgttcgggggcatgccgcgtttgccgaaggcgttggtgaaatacta
acgccggtggatccgccagagaagtggtatctggtggcgcaccctggtgtaagtattccg
actccggtgatttttaaagatcctgaactcccgcgcaatacgccaaaaaggtcaatagaa
acgttgctaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggtgctttcctggctgttagaatacgccccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacagagtctgaagcccgccaggtgctagagcaa
gccccggaatggctcaatggctttgtggcgaaaggcgctaatctttccccattgcacaga
gccatgctttaa

DBGET integrated database retrieval system