KEGG   Escherichia coli K-12 MG1655: b1215Help
Entry
b1215             CDS       T00007                                 

Gene name
kdsA
Definition
(RefSeq) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (EC:2.5.1.55)
  KO
K01627  
2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    b1215 (kdsA)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     b1215 (kdsA)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Unusual sugar
  b1215 (kdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1268165..1269019
Genome map
AA seq 284 aa AA seqDB search
MKQKVVSIGDINVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDK
ANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLAR
QTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDNLVVD
MLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGLFIEA
HPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKGFEELDTSK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaagtggttagcattggcgacatcaacgtagcaaatgacctgccgttcgta
ctgtttggcggtatgaacgtgttggaatctcgcgatctggcgatgcgcatttgcgagcac
tacgtaactgtgacccagaaactgggtatcccttacgtgttcaaagcctcttttgacaaa
gccaaccgctcctccatccactcttatcgtggaccgggcctggaagaagggatgaaaatc
ttccaggagttgaagcagacttttggcgtgaaaattatcaccgacgttcacgaaccaagt
caggcacagcccgttgctgatgtcgtggatgtgattcagttgccggcgtttcttgctcgc
cagactgacctggttgaagccatggcgaaaaccggtgcggtaattaacgtcaagaaacca
cagtttgtcagcccgggacagatgggtaatatcgttgataaattcaaagaaggcggcaac
gaaaaagtgattctttgcgatcgcggtgctaacttcggctatgacaacctggttgtcgat
atgctgggcttcagcattatgaagaaagtgtctggtaactcgccggtgattttcgacgtg
acccacgcactgcaatgccgcgatccgtttggcgcagcttccggtggtcgtcgtgctcag
gtggctgagctggcacgagccggtatggcggtaggtctggcggggctgtttattgaagcg
catccggatccggaacatgcgaaatgtgatggtccatccgcgctgccgctggctaaactg
gaaccgttcctcaagcagatgaaagcgattgatgatctggtgaaaggtttcgaagaactg
gataccagcaagtaa

DBGET integrated database retrieval system