KEGG   Escherichia coli K-12 MG1655: b1224Help
Entry
b1224             CDS       T00007                                 

Gene name
narG
Definition
(RefSeq) nitrate reductase 1, alpha subunit (EC:1.7.99.4)
  KO
K00370  
nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    b1224 (narG)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1224 (narG)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     b1224 (narG)
   1.7.99  With unknown physiological acceptors
    1.7.99.4  nitrate reductase
     b1224 (narG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1279864..1283607
Genome map
AA seq 1247 aa AA seqDB search
MSKFLDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSW
KIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLKYPMMRKRLMK
MWREAKALHSDPVEAWASIIEDADKAKSFKQARGRGGFVRSSWQEVNELIAASNVYTIKN
YGPDRVAGFSPIPAMSMVSYASGARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPE
SADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQ
GTDAAMALAMGHVMLREFHLDNPSQYFTDYVRRYTDMPMLVMLEERDGYYAAGRMLRAAD
LVDALGQENNPEWKTVAFNTNGEMVAPNGSIGFRWGEKGKWNLEQRDGKTGEETELQLSL
LGSQDEIAEVGFPYFGGDGTEHFNKVELENVLLHKLPVKRLQLADGSTALVTTVYDLTLA
NYGLERGLNDVNCATSYDDVKAYTPAWAEQITGVSRSQIIRIAREFADNADKTHGRSMII
VGAGLNHWYHLDMNYRGLINMLIFCGCVGQSGGGWAHYVGQEKLRPQTGWQPLAFALDWQ
RPARHMNSTSYFYNHSSQWRYETVTAEELLSPMADKSRYTGHLIDFNVRAERMGWLPSAP
QLGTNPLTIAGEAEKAGMNPVDYTVKSLKEGSIRFAAEQPENGKNHPRNLFIWRSNLLGS
SGKGHEFMLKYLLGTEHGIQGKDLGQQGGVKPEEVDWQDNGLEGKLDLVVTLDFRLSSTC
LYSDIILPTATWYEKDDMNTSDMHPFIHPLSAAVDPAWEAKSDWEIYKAIAKKFSEVCVG
HLGKETDIVTLPIQHDSAAELAQPLDVKDWKKGECDLIPGKTAPHIMVVERDYPATYERF
TSIGPLMEKIGNGGKGIAWNTQSEMDLLRKLNYTKAEGPAKGQPMLNTAIDAAEMILTLA
PETNGQVAVKAWAALSEFTGRDHTHLALNKEDEKIRFRDIQAQPRKIISSPTWSGLEDEH
VSYNAGYTNVHELIPWRTLSGRQQLYQDHQWMRDFGESLLVYRPPIDTRSVKEVIGQKSN
GNQEKALNFLTPHQKWGIHSTYSDNLLMLTLGRGGPVVWLSEADAKDLGIADNDWIEVFN
SNGALTARAVVSQRVPAGMTMMYHAQERIVNLPGSEITQQRGGIHNSVTRITPKPTHMIG
GYAHLAYGFNYYGTVGSNRDEFVVVRKMKNIDWLDGEGNDQVQESVK
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattcctggaccggtttcgctacttcaaacagaagggtgaaacctttgccgat
gggcatggccagcttctcaataccaaccgtgactgggaggatggatatcgccagcgttgg
cagcatgacaaaatcgtccgctctacccacggggtaaactgcaccggctcctgcagctgg
aaaatctacgtcaaaaacggtctggtcacctgggaaacccagcagactgactatccgcgt
acccgtccggatctgccaaaccatgaacctcgcggctgcccgcgcggtgccagctactcc
tggtatctttacagtgccaaccgcctgaaatacccgatgatgcgcaaacgcctgatgaaa
atgtggcgtgaagcgaaggcgctgcatagcgatccggttgaggcatgggcttctatcatt
gaagacgccgataaagcgaaaagctttaagcaggcgcgtggacgcggtggatttgttcgt
tcttcctggcaggaggtgaacgaactgatcgccgcatctaacgtttacaccatcaaaaac
tacggcccggaccgtgttgctggtttctcgccaattccggcaatgtcgatggtttcttac
gcatcgggtgcacgctatctctcgctgattggcggtacttgcttaagcttctacgactgg
tactgcgacttgcctcctgcgtctccgcaaacctggggcgagcaaactgacgtaccggaa
tctgctgactggtacaactccagctacatcatcgcctgggggtcaaacgtgccgcagacg
cgtaccccggatgctcacttctttactgaagtgcgttacaaagggaccaaaactgttgcc
gtcacaccagactacgctgaaatcgccaaactgtgcgatctgtggctggcaccgaaacag
ggcaccgatgcggcaatggcgctggcgatgggccacgtaatgctgcgtgaattccacctc
gacaacccaagccagtatttcaccgactatgtgcgtcgctacaccgacatgccgatgctg
gtgatgctggaagaacgcgacggttactacgctgcaggtcgtatgctgcgcgctgctgat
ctggttgatgcgctgggccaggaaaacaatccggaatggaaaactgtcgcctttaatacc
aatggcgaaatggttgcgccgaacggttctattggcttccgctggggcgagaagggcaaa
tggaatcttgagcagcgcgacggcaaaactggcgaagaaaccgagctgcaactgagcctg
ctgggtagccaggatgagatcgctgaggtaggcttcccgtactttggtggcgacggcacg
gaacacttcaacaaagtggaactggaaaacgtgctgctgcacaaactgccggtgaaacgc
ctgcaactggctgatggcagcaccgccctggtgaccaccgtttatgatctgacgctggca
aactacggtctggaacgtggcctgaacgacgttaactgtgcaaccagctatgacgatgtg
aaagcttataccccggcctgggccgagcagattaccggcgtttctcgcagccagattatt
cgcatcgcccgtgaatttgccgataacgctgataaaacgcacggtcgttcgatgattatc
gtcggtgcggggctgaaccactggtatcacctcgatatgaactatcgtggtctgatcaac
atgctgattttctgcggctgtgtcggtcagagcgggggcggctgggcgcactatgtaggt
caggaaaaactgcgtccgcaaaccggctggcagccgctggcgtttgcccttgactggcag
cgtccggcgcgtcacatgaacagcacttcttatttctataaccactccagccagtggcgt
tatgaaaccgtcacggcggaagagttgctgtcaccgatggcggacaaatcccgctatacc
ggacacttgatcgactttaacgtccgtgcggaacgcatgggctggctgccgtctgcaccg
cagttaggcactaacccgctgactatcgctggcgaagcggaaaaagccgggatgaatccg
gtggactatacggtgaaatccctgaaagagggttccatccgttttgcggcagaacaacca
gaaaacggtaaaaaccacccgcgcaacctgttcatctggcgttctaacctgctcggttct
tccggtaaaggtcatgagtttatgctcaagtacctgctggggacggagcacggtatccag
ggtaaagatctggggcaacagggcggcgtgaagccggaagaagtggactggcaggacaat
ggtctggaaggcaagctggatctggtggttacgctggacttccgtctgtcgagcacctgt
ctctattccgacatcattttgccgacggcgacctggtacgaaaaagacgacatgaatact
tcggatatgcatccgtttattcacccgctgtctgcggcggtcgatccggcctgggaagcg
aaaagcgactgggaaatctacaaagccatcgcgaagaaattctccgaagtgtgcgtcggc
catctgggtaaagaaaccgacatcgtcacgctgcctatccagcatgactctgccgctgaa
ctggcgcagccgctggatgtgaaagactggaaaaaaggcgagtgcgacctgatcccaggt
aaaaccgcgccacacattatggtcgtagagcgcgattatccggcgacttacgaacgcttt
acctctatcggcccgctgatggagaaaatcggtaatggcggtaaagggattgcctggaac
acccagagcgagatggatctgctgcgtaagctcaactacaccaaagcggaaggtccggcg
aaaggccagccgatgctgaacaccgcaattgatgcggcagagatgatcctgacactggca
ccggaaaccaacggtcaggtagccgtgaaagcctgggctgccctgagcgaatttaccggt
cgtgaccatacgcatctggcgctgaataaagaagacgagaagatccgcttccgcgatatt
caggcacagccgcgcaaaattatctccagcccgacctggtctggtctggaagatgaacac
gtttcttacaacgccggttacaccaacgttcacgagctgatcccatggcgtacgctctct
ggtcgtcagcaactgtatcaggatcaccagtggatgcgtgatttcggtgaaagcctgctg
gtttatcgtccgccgatcgacacccgttcggtgaaagaagtgataggccagaaatccaac
ggcaaccaggaaaaagcgctcaacttcctgacgccgcaccagaagtggggtatccactcc
acctacagcgacaacctgctgatgctgactttaggtcgcggtggtccggtggtctggttg
agtgaagccgatgccaaagatctgggtatcgccgataacgactggattgaagtcttcaac
agcaacggtgctctgactgcccgtgcggttgtcagccagcgtgttccggcagggatgacc
atgatgtaccacgcgcaggaacgtatcgttaacctgcctggttcggaaattacccaacag
cgtggtggtatccataactcggtcacccgtatcacgccgaaaccgacgcatatgatcggc
ggctatgcccatctggcatacggctttaactactatggcaccgtaggttctaaccgcgat
gagtttgttgtagtgcgtaagatgaagaacattgactggttagatggcgaaggcaatgac
caggtacaggagagcgtaaaatga

DBGET integrated database retrieval system