KEGG   Escherichia coli K-12 MG1655: b1225Help
Entry
b1225             CDS       T00007                                 

Gene name
narH
Definition
(RefSeq) nitrate reductase 1, beta (Fe-S) subunit (EC:1.7.99.4)
  KO
K00371  
nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    b1225 (narH)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1225 (narH)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     b1225 (narH)
   1.7.99  With unknown physiological acceptors
    1.7.99.4  nitrate reductase
     b1225 (narH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1283604..1285142
Genome map
AA seq 512 aa AA seqDB search
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKPGQGFPTDWENQE
KYKGGWIRKINGKLQPRMGNRAMLLGKIFANPHLPGIDDYYEPFDFDYQNLHTAPEGSKS
QPIARPRSLITGERMAKIEKGPNWEDDLGGEFDKLAKDKNFDNIQKAMYSQFENTFMMYL
PRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGK
SEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKDLYQRQLDVF
LDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMVWYVPPLS
PIQSAADAGELGSNGILPDVESLRIPVQYLANLLTAGDTKPVLRALKRMLAMRHYKRAET
VDGKVDTRALEEVGLTEAQAQEMYRYLAIANYEDRFVVPSSHRELAREAFPEKNGCGFTF
GDGCHGSDTKFNLFNSRRIDAIDVTSKTEPHP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgttcacaagtcggcatggtgctgaatctcgataagtgcatcggctgccac
acctgttcagttacctgtaaaaacgtctggaccagccgtgaaggcgtggaatatgcgtgg
ttcaacaacgtggaaaccaagccgggccagggcttcccgactgactgggaaaaccaggaa
aaatacaaaggcggctggatccgtaaaatcaacggcaaactgcagccgcgcatgggtaac
cgtgccatgctgctgggtaaaatcttcgctaacccgcatctgccggggatcgacgattat
tacgagccgttcgattttgactatcagaacctgcataccgcgccggaaggcagcaaatcg
cagccgattgcccgtccgcgttcgctgattaccggggaacggatggcgaaaatcgaaaaa
gggccgaactgggaagatgacctgggcggtgagtttgacaaactggcgaaagacaagaac
ttcgacaacatccagaaggcgatgtatagccagttcgaaaacaccttcatgatgtatttg
ccgcgcctgtgcgaacactgcctgaacccggcatgtgtggcgacctgcccgagcggtgcg
atttacaagcgtgaagaagatggcatcgtcctgatcgaccaggataaatgccgtggctgg
cgtatgtgcatcactggatgcccgtacaaaaaaatctacttcaactggaagagcggtaag
tctgagaagtgcatcttctgctatccgcgtattgaagcgggtcagccgaccgtgtgctca
gaaacctgtgtcggtcgtatccgttatcttggcgtgctgttgtacgatgccgacgctatt
gaacgtgcagccagcaccgagaacgagaaagatctttaccagcgtcagctggacgtgttc
ctcgatccgaacgatccgaaagtcatcgagcaggcgattaaagacggtattccgctgagc
gttattgaagccgcacagcagtcgccggtttataaaatggcaatggaatggaaactggcg
ctgccgctgcatccggaatatcgcacactgccgatggtctggtacgtgccgcctctgtct
ccgattcagtctgcagcagacgcgggtgagctgggtagcaacggcattctgccagacgtc
gaaagcctgcgtattccggtacagtatctggcgaatctgctgaccgccggtgataccaaa
ccggtactgcgcgcactgaaacgtatgctggcgatgcgtcattacaaacgtgctgaaacc
gttgacggtaaagttgatacccgtgcgctggaagaggtcggtctgaccgaagcccaggca
caggagatgtaccgttatctggcgattgctaactacgaagatcgctttgtggtgccgagt
agtcatcgtgaactggcacgggaagccttcccggagaaaaatggctgcggctttaccttt
ggtgatggctgccacggttcagataccaaattcaatctgttcaacagccgtcgtatcgat
gccatcgatgtgaccagcaaaacggagccgcatccatga

DBGET integrated database retrieval system