KEGG   Escherichia coli K-12 MG1655: b1225Help
Entry
b1225             CDS       T00007                                 

Gene name
narH
Definition
(RefSeq) nitrate reductase 1, beta (Fe-S) subunit
  KO
K00371  
nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    b1225 (narH)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1225 (narH)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     b1225 (narH)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     b1225 (narH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1283604..1285142
Genome map
AA seq 512 aa AA seqDB search
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKPGQGFPTDWENQE
KYKGGWIRKINGKLQPRMGNRAMLLGKIFANPHLPGIDDYYEPFDFDYQNLHTAPEGSKS
QPIARPRSLITGERMAKIEKGPNWEDDLGGEFDKLAKDKNFDNIQKAMYSQFENTFMMYL
PRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGK
SEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKDLYQRQLDVF
LDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMVWYVPPLS
PIQSAADAGELGSNGILPDVESLRIPVQYLANLLTAGDTKPVLRALKRMLAMRHYKRAET
VDGKVDTRALEEVGLTEAQAQEMYRYLAIANYEDRFVVPSSHRELAREAFPEKNGCGFTF
GDGCHGSDTKFNLFNSRRIDAIDVTSKTEPHP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgttcacaagtcggcatggtgctgaatctcgataagtgcatcggctgccac
acctgttcagttacctgtaaaaacgtctggaccagccgtgaaggcgtggaatatgcgtgg
ttcaacaacgtggaaaccaagccgggccagggcttcccgactgactgggaaaaccaggaa
aaatacaaaggcggctggatccgtaaaatcaacggcaaactgcagccgcgcatgggtaac
cgtgccatgctgctgggtaaaatcttcgctaacccgcatctgccggggatcgacgattat
tacgagccgttcgattttgactatcagaacctgcataccgcgccggaaggcagcaaatcg
cagccgattgcccgtccgcgttcgctgattaccggggaacggatggcgaaaatcgaaaaa
gggccgaactgggaagatgacctgggcggtgagtttgacaaactggcgaaagacaagaac
ttcgacaacatccagaaggcgatgtatagccagttcgaaaacaccttcatgatgtatttg
ccgcgcctgtgcgaacactgcctgaacccggcatgtgtggcgacctgcccgagcggtgcg
atttacaagcgtgaagaagatggcatcgtcctgatcgaccaggataaatgccgtggctgg
cgtatgtgcatcactggatgcccgtacaaaaaaatctacttcaactggaagagcggtaag
tctgagaagtgcatcttctgctatccgcgtattgaagcgggtcagccgaccgtgtgctca
gaaacctgtgtcggtcgtatccgttatcttggcgtgctgttgtacgatgccgacgctatt
gaacgtgcagccagcaccgagaacgagaaagatctttaccagcgtcagctggacgtgttc
ctcgatccgaacgatccgaaagtcatcgagcaggcgattaaagacggtattccgctgagc
gttattgaagccgcacagcagtcgccggtttataaaatggcaatggaatggaaactggcg
ctgccgctgcatccggaatatcgcacactgccgatggtctggtacgtgccgcctctgtct
ccgattcagtctgcagcagacgcgggtgagctgggtagcaacggcattctgccagacgtc
gaaagcctgcgtattccggtacagtatctggcgaatctgctgaccgccggtgataccaaa
ccggtactgcgcgcactgaaacgtatgctggcgatgcgtcattacaaacgtgctgaaacc
gttgacggtaaagttgatacccgtgcgctggaagaggtcggtctgaccgaagcccaggca
caggagatgtaccgttatctggcgattgctaactacgaagatcgctttgtggtgccgagt
agtcatcgtgaactggcacgggaagccttcccggagaaaaatggctgcggctttaccttt
ggtgatggctgccacggttcagataccaaattcaatctgttcaacagccgtcgtatcgat
gccatcgatgtgaccagcaaaacggagccgcatccatga

DBGET integrated database retrieval system