KEGG   Escherichia coli K-12 MG1655: b1237Help
Entry
b1237             CDS       T00007                                 

Gene name
hns
Definition
(RefSeq) global DNA-binding transcriptional dual regulator H-NS
  KO
K03746  
DNA-binding protein H-NS
Organism
eco  Escherichia coli K-12 MG1655
Brite
Chromosome [BR:eco03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HNS (histone-like nucleoid structuring protein)
    b1237 (hns)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      b1237 (hns)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1292509..1292922)
Genome map
AA seq 137 aa AA seqDB search
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQ
YREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIK
KAMDEQGKSLDDFLIKQ
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcacttaaaattctgaacaacatccgtactcttcgtgcgcaggcaagagaa
tgtacacttgaaacgctggaagaaatgctggaaaaattagaagttgttgttaacgaacgt
cgcgaagaagaaagcgcggctgctgctgaagttgaagagcgcactcgtaaactgcagcaa
tatcgcgaaatgctgatcgctgacggtattgacccgaacgaactgctgaatagccttgct
gccgttaaatctggcaccaaagctaaacgtgctcagcgtccggcaaaatatagctacgtt
gacgaaaacggcgaaactaaaacctggactggccaaggccgtactccagctgtaatcaaa
aaagcaatggatgagcaaggtaaatccctcgacgatttcctgatcaagcaataa

DBGET integrated database retrieval system