KEGG   Escherichia coli K-12 MG1655: b1262Help
Entry
b1262             CDS       T00007                                 

Gene name
trpC
Definition
fused indole-3-glycerolphosphate synthetase/N-(5-phosphoribosyl)anthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    b1262 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    b1262 (trpC)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     b1262 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     b1262 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
Structure
PDB: 

Jmol
Position
complement(1318427..1319788)
Genome map
AA seq 453 aa AA seqDB search
MMQTVLAKIVADKAIWVEARKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASP
SKGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFNFLPIVSQIAPQPILCKDFIID
PYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIALGAK
VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSAL
MAHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEV
MAAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEEQLYIDTLREALPAHVAIWKAL
SVGETLPAREFQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQT
GCAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgc
aaacagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttt
tatgatgcgctacagggtgcgcgcacggcgtttattctggagtgcaagaaagcgtcgccg
tcaaaaggcgtgatccgtgatgatttcgatccagcacgcattgccgccatttataaacat
tacgcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttaatttc
ctccccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgac
ccttaccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttca
gtactggatgacgaccaatatcgccagcttgccgccgtcgctcacagtctggagatgggg
gtgctgaccgaagtcagtaatgaagaggaacaggagcgcgccattgcattgggagcaaag
gtcgttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgc
gagcttgcgccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatact
tacgctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttg
atggcccatgacgatttgcacgccgccgtgcgccgggtgttgctgggtgagaataaagta
tgtggcctgacgcgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggt
gggttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtg
atggctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtg
gtggacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagaacag
ctgtatatcgatacgctgcgtgaagctctgccagcacatgttgccatctggaaagcatta
agcgtcggtgaaaccctgcccgcccgcgagtttcagcacgttgataaatatgttttagac
aacggccagggtggaagcgggcaacgttttgactggtcactattaaatggtcaatcgctt
ggcaacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaacc
ggctgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgca
cgtcttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system