KEGG   Escherichia coli K-12 MG1655: b1267Help
Entry
b1267             CDS       T00007                                 

Gene name
yciO
Definition
(RefSeq) putative RNA binding protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC FlbD Methyltr_RsmB-F
Motif
Other DBs
NCBI-GeneID: 945854
NCBI-ProteinID: NP_415783
Pasteur: yciO
RegulonDB: ECK120003230
ECOCYC: G6635
ASAP: ABE-0004254
UniProt: P0AFR4
Structure
PDB: 

Jmol
Position
1324098..1324718
Genome map
AA seq 206 aa AA seqDB search
MSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLP
DGHNFTLMCRDLSELSTYSFVDNVAFRLMKNNTPGNYTFILKGTKEVPRRLLQEKRKTIG
MRVPSNPIAQALLEALGEPMLSTSLMLPGSEFTESDPEEIKDRLEKQVDLIIHGGYLGQK
PTTVIDLTDDTPVVVREGVGDVKPFL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtttttttatattcatcctgataacccacagcaacgtctgatcaaccaggcg
gtggagatcgtgcgtaaaggcggggtgattgtttatccaactgattccggctatgcgctc
ggctgtaaaattgaagataaaaacgcgatggagcgtatttgtcgtattcgccagctgccg
gacggtcacaactttaccctgatgtgtcgcgatctttctgaactctcgacctattcattt
gttgataacgttgcgtttcgtttaatgaaaaacaacacgccgggcaactataccttcatc
ctgaaggggacgaaggaagtgccacgccgtctgttgcaggaaaaacgcaaaaccatcggt
atgcgtgtgccttctaaccctatcgctcaggcgttacttgaagcattgggcgaaccgatg
ctttccacttcgctaatgctgccaggcagcgaatttaccgaatcggacccggaagaaatt
aaagatcgtctggaaaaacaggtagatttgattattcacggcggctatctcgggcagaaa
ccgacaacggttattgatcttaccgatgatacgccggtcgtggtgcgtgaaggcgtaggt
gatgtgaagcctttcttataa

DBGET integrated database retrieval system