KEGG   Escherichia coli K-12 MG1655: b1303Help
Entry
b1303             CDS       T00007                                 

Gene name
pspF
Definition
(RefSeq) psp operon transcriptional activator
  KO
K03974  
psp operon transcriptional activator
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Other transcription factors
   Others
    b1303 (pspF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1366935..1367912)
Genome map
AA seq 325 aa AA seqDB search
MAEYKDNLLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPF
ISLNCAALNENLLDSELFGHEAGAFTGAQKRHPGRFERADGGTLFLDELATAPMMVQEKL
LRVIEYGELERVGGSQPLQVNVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLR
ERESDIMLMAEYFAIQMCREIKLPLFPGFTERARETLLNYRWPGNIRELKNVVERSVYRH
GTSDYPLDDIIIDPFKRRPPEDAIAVSETTSLPTLPLDLREFQMQQEKELLQLSLQQGKY
NQKRAAELLGLTYHQFRALLKKHQI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatacaaagataatttacttggtgaggcgaacagctttctcgaagtgctggaa
caggtttcgcatctcgcaccgctggacaaaccggtgctcatcatcggcgaacgcggcacc
ggtaaagagctgattgccagccgcctgcattatctctcctcccgttggcaagggccgttt
atttcccttaactgcgcggcgttaaatgaaaatctgctggattccgaactgtttggtcac
gaagcgggggcgtttaccggtgcgcaaaaacgtcatccagggagatttgaacgtgccgac
ggcggtacgctatttcttgatgaactcgctacggcaccgatgatggtgcaggagaaatta
ttgcgcgtgattgagtacggtgaactggagcgcgttggcggcagccaaccattgcaggtg
aatgtgcggttggtatgcgcgacgaatgccgatctcccggcgatggtcaatgaaggcact
tttcgcgctgacctgctcgaccgactggcttttgatgttgtacaactgccaccactgcgc
gagcgcgaaagcgacataatgttgatggcagaatactttgccatccagatgtgtcgggaa
atcaagctgcctctgttcccggggtttacggagcgcgccagagaaacattgctgaattat
cgttggccgggaaatattcgtgaattgaaaaacgtggtggaacgttcagtgtatcgccac
ggcaccagcgattatccgcttgatgacatcattattgatccctttaaacggcgtccgcct
gaagacgctatcgccgtttcagaaaccacctcgcttccaacactgccgctggatttacgt
gagtttcagatgcagcaggaaaaagagttgctgcaactcagtttgcaacaagggaaatat
aaccagaagcgcgcggctgaattactggggttaacttatcatcagttccgcgcgttgttg
aaaaagcaccagatttag

DBGET integrated database retrieval system