KEGG   Escherichia coli K-12 MG1655: b1311Help
Entry
b1311             CDS       T00007                                 

Gene name
ycjO
Definition
(RefSeq) putative sugar ABC transporter permease
  KO
K02025  multiple sugar transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Module
eco_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    b1311 (ycjO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 945888
NCBI-ProteinID: NP_415827
Pasteur: ycjO
RegulonDB: ECK120003244
ECOCYC: G6649
ASAP: ABE-0004405
UniProt: P0AFR7
Position
1373222..1374103
Genome map
AA seq 293 aa AA seqDB search
MNRLFSGRSDMPFALLLLAPSLLLLGGLVAWPMVSNIEISFLRLPLNPNIESTFVGVSNY
VRILSDPGFWHSLWMTVWYTALVVAGSTVLGLAVAMFFNREFRLRKTARSLVILSYVTPS
ISLVFAWKYMFNNGYGIVNYLGVDLLHLYEQAPLWFDNPGSSFVLVVLFAIWRYFPYAFI
SFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAIMPVLATVVTLRTIWMFYMFADVYL
LTTKVDILGVYLYKTAFAFNDLGKAAAISVVLFIIIFAVILLTRKRVNLNGNK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggcttttttcaggtcgttccgatatgccctttgcgctgctgcttctcgcgccc
agcttattactgctgggcggtctggtggcgtggccgatggtgtcgaatatcgaaatcagt
tttttacgtctgccgctcaatcccaacatcgagtcaacgtttgttggggtgagcaactat
gtgcgtatcctctccgatcccggcttctggcattcgctgtggatgacggtctggtatacc
gcgctggtggtggcgggcagcaccgtgctcgggctggcggtggcgatgtttttcaaccgc
gagttccgcctgcgcaaaaccgcgcgttcgctggtgatcctctcctacgtaacgccgtcc
atttcgctggtgttcgcctggaaatacatgttcaacaacggctacggcattgttaactac
ctcggcgtcgatcttctgcatctctatgagcaggcaccgctgtggttcgataatccgggc
agtagctttgtgctggtggtgctgttcgccatctggcgctacttcccgtatgcctttatc
tcgtttctggcgattttgcagaccatcgacaaatcgctgtacgaagcggcagagatggat
ggcgctaatgcctggcaacggtttcgtatcgtcacgctgcccgcaattatgccggtcctg
gcgacggtggtgacactgcgcaccatctggatgttctacatgttcgcggatgtttatttg
ctgacgaccaaggtcgatattctcggtgtatatctctacaaaaccgcctttgcctttaat
gatttaggaaaagcggcggcgatctcggtggtgctcttcatcattattttcgctgtcatt
ctgctgaccaggaaacgggtgaacctcaatggcaacaaataa

DBGET integrated database retrieval system