KEGG   Escherichia coli K-12 MG1655: b1311Help
Entry
b1311             CDS       T00007                                 

Gene name
ycjO
Definition
(RefSeq) inner membrane putative ABC superfamily sugar transporter permease
  KO
K02025  
multiple sugar transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Putative multiple sugar transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    b1311 (ycjO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1373222..1374103
Genome map
AA seq 293 aa AA seqDB search
MNRLFSGRSDMPFALLLLAPSLLLLGGLVAWPMVSNIEISFLRLPLNPNIESTFVGVSNY
VRILSDPGFWHSLWMTVWYTALVVAGSTVLGLAVAMFFNREFRLRKTARSLVILSYVTPS
ISLVFAWKYMFNNGYGIVNYLGVDLLHLYEQAPLWFDNPGSSFVLVVLFAIWRYFPYAFI
SFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAIMPVLATVVTLRTIWMFYMFADVYL
LTTKVDILGVYLYKTAFAFNDLGKAAAISVVLFIIIFAVILLTRKRVNLNGNK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggcttttttcaggtcgttccgatatgccctttgcgctgctgcttctcgcgccc
agcttattactgctgggcggtctggtggcgtggccgatggtgtcgaatatcgaaatcagt
tttttacgtctgccgctcaatcccaacatcgagtcaacgtttgttggggtgagcaactat
gtgcgtatcctctccgatcccggcttctggcattcgctgtggatgacggtctggtatacc
gcgctggtggtggcgggcagcaccgtgctcgggctggcggtggcgatgtttttcaaccgc
gagttccgcctgcgcaaaaccgcgcgttcgctggtgatcctctcctacgtaacgccgtcc
atttcgctggtgttcgcctggaaatacatgttcaacaacggctacggcattgttaactac
ctcggcgtcgatcttctgcatctctatgagcaggcaccgctgtggttcgataatccgggc
agtagctttgtgctggtggtgctgttcgccatctggcgctacttcccgtatgcctttatc
tcgtttctggcgattttgcagaccatcgacaaatcgctgtacgaagcggcagagatggat
ggcgctaatgcctggcaacggtttcgtatcgtcacgctgcccgcaattatgccggtcctg
gcgacggtggtgacactgcgcaccatctggatgttctacatgttcgcggatgtttatttg
ctgacgaccaaggtcgatattctcggtgtatatctctacaaaaccgcctttgcctttaat
gatttaggaaaagcggcggcgatctcggtggtgctcttcatcattattttcgctgtcatt
ctgctgaccaggaaacgggtgaacctcaatggcaacaaataa

DBGET integrated database retrieval system