KEGG   Escherichia coli K-12 MG1655: b1329Help
Entry
b1329             CDS       T00007                                 

Gene name
mppA
Definition
(RefSeq) murein tripeptide (L-ala-gamma-D-glutamyl-meso-DAP) transporter subunit
  KO
K15580  
oligopeptide transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
beta-Lactam resistance
ABC transporters
Module
Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b1329 (mppA)
 Human Diseases
  Antimicrobial resistance
   01501 beta-Lactam resistance
    b1329 (mppA)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    b1329 (mppA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1393227..1394840
Genome map
AA seq 537 aa AA seqDB search
MKHSVSVTCCALLVSSISLSYAAEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQ
VIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQ
RLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNL
TANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQ
KVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQ
KGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEEL
NAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTY
IDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVK
ARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaagcactctgtttcagtcacgtgttgtgcgctgttggtcagcagcatttctctttcg
tatgctgcagaagttccgagcggcacagtactggcagagaagcaggagctggtgcgccac
attaaagatgagcctgcgtcgctggatcccgctaaagccgtgggcctgccagagattcag
gtcattcgcgatctgtttgaaggtctggtgaatcagaacgaaaaaggggagattgtcccc
ggcgttgcgactcagtggaaaagtaatgacaaccgtatctggacttttaccctgcgcgat
aacgcaaaatgggcggatggcacaccggtaacggcgcaagattttgtctacagctggcaa
cgtctggtggacccaaaaacattgtcgccatttgcatggtttgccgcgctggcgggaatc
aacaacgcacaggcgattattgatggtaaagctacgcctgaccagcttggcgtcaccgca
gttgatgcccatactttgaaaattcagcttgataaaccgttgccgtggtttgtgaattta
accgctaactttgccttcttcccggtgcaaaaagccaacgtagaaagcggtaaagagtgg
acgaaacccggaaatctgatcggcaatggcgcttatgttcttaaagagcgcgtagtcaat
gaaaaactggtcgtggtaccgaatacccattattgggataacgccaaaacggtactgcaa
aaagtgaccttcctgccaattaatcaggaatccgcagccactaagcgttacctcgcgggg
gatattgatatcaccgaatccttcccgaaaaatatgtatcagaagctgttgaaggatatt
ccggggcaggtttatacgccgccgcagctcgggacctattattatgcgtttaacacgcaa
aaagggccgacggcagatcagcgcgttcgtctggcattaagtatgacgatagatcgccgc
ctgatgaccgaaaaagtattagggacgggcgaaaagccagcgtggcattttacaccagat
gttaccgcgggatttacgccggaaccttcgccgtttgaacaaatgagtcaggaagaactg
aatgcgcaggcaaaaactttgttgagcgcagctggttatggtccgcaaaaaccgctgaag
ctgacgcttttgtataacacttcagaaaaccatcaaaaaattgcgattgctgtagcatcg
atgtggaaaaagaaccttggcgtagatgttaaattgcaaaatcaggaatggaaaacctat
atcgatagccgtaacaccggcaattttgatgttatccgcgcctcgtgggtgggggattat
aatgaaccctccactttcctgacattattaacgtcaacgcattcaggaaatatttcacgc
tttaacaatccggcatatgacaaagttctggcccaggcatcgacggaaaataccgttaaa
gcgcgtaatgccgattacaacgcggcagaaaaaatcctcatggagcaagcaccgattgca
ccaatttatcaatataccaatggacgattaatcaagccgtggctgaaaggttatcccatt
aataatcctgaagatgtggcgtacagtcggactatgtatattgtgaagcattga

DBGET integrated database retrieval system