KEGG   Escherichia coli K-12 MG1655: b1330Help
Entry
b1330             CDS       T00007                                 

Gene name
ynaI
Definition
(RefSeq) mechanosensitive channel protein, very small conductance
  KO
K16052  
MscS family membrane protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b1330 (ynaI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1394891..1395922)
Genome map
AA seq 343 aa AA seqDB search
MIAELFTNNALNLVIIFGSCAALILMSFWFRRGNRKRKGFLFHAVQFLIYTIIISAVGSI
INYVIENYKLKFITPGVIDFICTSLIAVILTIKLFLLINQFEKQQIKKGRDITSARIMSR
IIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDRPFS
IGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTT
IGLRYEDAAKVGVIVEAVREMLKNHPAIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWA
EWLAAQQDVYLKIIDIVQSHGADFAFPSQTLYMDNITPPEQGR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctgaactgtttacaaataatgcgcttaatctggtcattattttcggtagctgc
gcagcattgattctgatgagcttttggtttcgccgtggaaatcgtaaaagaaaaggattt
ttattccatgcggtgcaatttttaatctacaccataattatcagtgctgttggtagcatt
attaattatgttatagaaaactataaactcaaatttatcaccccaggcgttatcgatttt
atctgtacgtccctgattgcggttattctgacgattaagctatttctgctgattaatcag
tttgaaaaacagcagattaaaaaaggtcgcgatatcaccagtgcgcggattatgtcgcgt
atcatcaaaatcaccattattgtggtgcttgttctgctttatggcgaacatttcggcatg
agcctttctggcttgctgacctttggtggtattggtggtctggctgtcggtatggccggt
aaagatattctgagtaacttcttttccgggattatgctctatttcgaccgtcctttcagt
attggcgactggatccgttcaccggacagaaatatcgaaggtacagtagcggaaattggc
tggcgaattaccaaaattacgacctttgataatcgtccattgtacgtaccgaactcgctg
ttttcgtcgatcagcgtagaaaacccaggacgaatgaccaaccgccgcattaccacgacc
attggtttacgttatgaggatgcggcaaaagtgggcgttattgtcgaagctgtacgtgag
atgctgaaaaatcacccggccatcgaccagcgacaaaccttactggtttatttcaaccag
tttgctgactcttcattgaatattatggtttattgctttaccaaaaccacggtatgggct
gaatggcttgctgcacagcaagacgtttatttgaagattatcgatattgtacagtcacac
ggcgcggactttgccttccccagccagacgctgtatatggataacattacaccgccggaa
cagggtcgctaa

DBGET integrated database retrieval system