KEGG   Escherichia coli K-12 MG1655: b1343Help
Entry
b1343             CDS       T00007                                 

Gene name
dbpA
Definition
(RefSeq) ATP-dependent RNA helicase, specific for 23S rRNA
  KO
K05591  
ATP-independent RNA helicase DbpA [EC:3.6.4.13]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     b1343 (dbpA)
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  rRNA helicases
   b1343 (dbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1409511..1410884
Genome map
AA seq 457 aa AA seqDB search
MTAFSTLNVLPPAQLTNLNELGYLTMTPVQAAALPAILAGKDVRVQAKTGSGKTAAFGLG
LLQQIDASLFQTQALVLCPTRELADQVAGELRRLARFLPNTKILTLCGGQPFGMQRDSLQ
HAPHIIVATPGRLLDHLQKGTVSLDALNTLVMDEADRMLDMGFSDAIDDVIRFAPASRQT
LLFSATWPEAIAAISGRVQRDPLAIEIDSTDALPPIEQQFYETSSKGKIPLLQRLLSLHQ
PSSCVVFCNTKKDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGSARVLVATDV
AARGLDIKSLELVVNFELAWDPEVHVHRIGRTARAGNSGLAISFCAPEEAQRANIISDML
QIKLNWQTPPANSSIATLEAEMATLCIDGGKKAKMRPGDVLGALTGDIGLDGADIGKIAV
HPAHVYVAVRQAVAHKAWKQLQGGKIKGKTCRVRLLK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctttttctaccctgaatgttttgcctcccgcccaactcacgaaccttaatgag
ttgggttatttaaccatgacgccggtgcaggccgccgcgcttccggcgatccttgccgga
aaagatgttcgcgtgcaggcgaaaaccggcagcggcaaaacggcggcttttggcctcggc
ttgttacagcaaattgatgcgtcgctatttcaaacccaggctttagtgctgtgtcctacg
cgtgaactggcggatcaggtggcaggtgaattgcgtcggctggcgcgttttctgccaaat
accaaaattttgacgttgtgcggtggtcaaccgttcggtatgcagcgtgattcgttgcaa
catgcgccgcatattatcgtggcaacgccggggcgtttgctggatcacctgcaaaaaggc
acggtatcactggatgcgttgaatacgctggtgatggatgaggccgaccgcatgctggat
atgggatttagcgatgccattgatgatgtcatccgttttgcgcctgcatctcgacagacg
cttctgttttcggcaacctggccggaagccatcgctgcaatcagcggacgagtgcaacgc
gatcctttggcgattgaaattgactcaacagatgctttgccacccattgaacaacaattt
tatgagacatccagcaaaggcaaaattcctctgttgcaacggttattaagcttgcatcag
ccatcctcttgcgtggtgttttgcaataccaaaaaagattgccaggctgtctgcgacgcg
ctgaatgaagtagggcaaagtgcattgtcattacacggcgatttggagcaacgcgatcgc
gatcagaccctggtacgttttgctaacggtagcgcccgtgtactggtcgcgactgatgtt
gctgcgcgtggtctggatattaaatcgcttgagctggtggtgaactttgagctggcgtgg
gaccctgaagttcatgtacatcgcatcggtcgtacagctcgtgcaggaaatagcggtctg
gcgatcagtttctgtgctccggaagaagcacagcgggccaatatcatttctgacatgttg
cagataaaacttaactggcaaacgccgccagctaatagttccattgcgacgctggaagca
gaaatggcaacgttgtgtatcgatggcgggaaaaaagccaaaatgcgcccgggtgatgta
ttaggtgcactgacaggagatatcgggcttgatggcgcagatattggcaaaatcgccgtg
catccggcgcatgtctatgtcgcggtccgtcaggctgttgctcataaagcatggaaacag
ttacagggcgggaagattaaaggaaaaacgtgccgggtgcggttattaaaataa

DBGET integrated database retrieval system