KEGG   Escherichia coli K-12 MG1655: b1393Help
Entry
b1393             CDS       T00007                                 

Gene name
paaF
Definition
(RefSeq) 2,3-dehydroadipyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00071  Fatty acid degradation
eco00280  Valine, leucine and isoleucine degradation
eco00281  Geraniol degradation
eco00310  Lysine degradation
eco00360  Phenylalanine metabolism
eco00362  Benzoate degradation
eco00380  Tryptophan metabolism
eco00410  beta-Alanine metabolism
eco00627  Aminobenzoate degradation
eco00640  Propanoate metabolism
eco00650  Butanoate metabolism
eco00903  Limonene and pinene degradation
eco00930  Caprolactam degradation
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01212  Fatty acid metabolism
Module
eco_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    b1393 (paaF)
   00650 Butanoate metabolism
    b1393 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    b1393 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    b1393 (paaF)
   00310 Lysine degradation
    b1393 (paaF)
   00360 Phenylalanine metabolism
    b1393 (paaF)
   00380 Tryptophan metabolism
    b1393 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    b1393 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    b1393 (paaF)
   00281 Geraniol degradation
    b1393 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    b1393 (paaF)
   00627 Aminobenzoate degradation
    b1393 (paaF)
   00930 Caprolactam degradation
    b1393 (paaF)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     b1393 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 946011
NCBI-ProteinID: NP_415911
Pasteur: paaF
RegulonDB: ECK120003308
ECOCYC: G6714
ASAP: ABE-0004659
UniProt: P76082
Structure
PDB: 

Jmol
Position
1457497..1458264
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatgcctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system