KEGG   Escherichia coli K-12 MG1655: b1464Help
Entry
b1464             CDS       T00007                                 

Gene name
yddE
Definition
(RefSeq) PhzC-PhzF family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhzC-PhzF
Motif
Other DBs
NCBI-GeneID: 944782
NCBI-ProteinID: NP_415981
Pasteur: yddE
RegulonDB: ECK120001757
ECOCYC: EG11825
ASAP: ABE-0004886
UniProt: P37757
Structure
PDB: 

Jmol
Position
complement(1534965..1535858)
Genome map
AA seq 297 aa AA seqDB search
MKPQVYHVDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHSETAFLLHSDDSDVRI
RYFTPTVEVPICGHATVAAHYVRAKVLGLGNCTIWQTSLAGKHRVTIEKHNDDYRISLEQ
GTPGFEPPLEGETRAAIINALHLTEDDILPGLPIQVATTGHSKVMIPLKPEVDIDALSPD
LNALTAISKKIGCNGFFPFQIRPGKNETDGRMFSPAIGIVEDPVTGNANGPMGAWLVHHN
VLPHDGNVLRVKGHQGRALGRDGMIEVTVTIRDNQPEKVTISGTAVILFHAEWAIEL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcaggtgtaccacgtcgatgcttttacctcacaaccgtttcgcggcaattct
gccggtgttgttttccccgccgataatcttagcgaagcgcaaatgcagcttatcgcccgc
gagttaggccattcggaaactgcttttctgctgcacagcgacgacagcgatgtgcgcatc
cgctactttacgccaacggttgaagtgccgatttgcggtcacgcgacagtagctgcgcac
tatgtacgtgcgaaggtgttaggtttaggaaattgcacgatctggcaaacatcgctggca
ggaaaacatcgcgtgactatcgaaaagcacaacgatgattatcgtatttcgctggaacaa
ggtacgccgggctttgagccaccgctggaaggtgaaacacgtgcggcgattatcaacgcg
cttcatctcactgaggacgatattctgccaggcttgccaattcaggtggcaacaacagga
cactcaaaagtgatgatcccactgaaaccggaagtggatatcgacgccctttcgcctgac
cttaatgcgctgaccgctatcagcaaaaagattggctgcaatggtttcttcccgttccag
atccgcccaggcaaaaacgaaaccgatggtcgcatgttctcgcctgcgattggtattgtg
gaagatccggtgactggcaatgccaatggcccgatgggtgcatggttggtacatcacaac
gtattgccccacgatggcaacgtgttgcgtgttaaaggccatcaggggcgcgcattgggg
cgtgacggtatgattgaagtgacggtgacaattcgtgataaccaaccggaaaaagtcacc
atttcaggcacagcggtgattttgtttcatgccgaatgggcaattgaactctga

DBGET integrated database retrieval system