KEGG   Escherichia coli K-12 MG1655: b1464Help
Entry
b1464             CDS       T00007                                 

Gene name
yddE
Definition
(RefSeq) PhzC-PhzF family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1534965..1535858)
Genome map
AA seq 297 aa AA seqDB search
MKPQVYHVDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHSETAFLLHSDDSDVRI
RYFTPTVEVPICGHATVAAHYVRAKVLGLGNCTIWQTSLAGKHRVTIEKHNDDYRISLEQ
GTPGFEPPLEGETRAAIINALHLTEDDILPGLPIQVATTGHSKVMIPLKPEVDIDALSPD
LNALTAISKKIGCNGFFPFQIRPGKNETDGRMFSPAIGIVEDPVTGNANGPMGAWLVHHN
VLPHDGNVLRVKGHQGRALGRDGMIEVTVTIRDNQPEKVTISGTAVILFHAEWAIEL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcaggtgtaccacgtcgatgcttttacctcacaaccgtttcgcggcaattct
gccggtgttgttttccccgccgataatcttagcgaagcgcaaatgcagcttatcgcccgc
gagttaggccattcggaaactgcttttctgctgcacagcgacgacagcgatgtgcgcatc
cgctactttacgccaacggttgaagtgccgatttgcggtcacgcgacagtagctgcgcac
tatgtacgtgcgaaggtgttaggtttaggaaattgcacgatctggcaaacatcgctggca
ggaaaacatcgcgtgactatcgaaaagcacaacgatgattatcgtatttcgctggaacaa
ggtacgccgggctttgagccaccgctggaaggtgaaacacgtgcggcgattatcaacgcg
cttcatctcactgaggacgatattctgccaggcttgccaattcaggtggcaacaacagga
cactcaaaagtgatgatcccactgaaaccggaagtggatatcgacgccctttcgcctgac
cttaatgcgctgaccgctatcagcaaaaagattggctgcaatggtttcttcccgttccag
atccgcccaggcaaaaacgaaaccgatggtcgcatgttctcgcctgcgattggtattgtg
gaagatccggtgactggcaatgccaatggcccgatgggtgcatggttggtacatcacaac
gtattgccccacgatggcaacgtgttgcgtgttaaaggccatcaggggcgcgcattgggg
cgtgacggtatgattgaagtgacggtgacaattcgtgataaccaaccggaaaaagtcacc
atttcaggcacagcggtgattttgtttcatgccgaatgggcaattgaactctga

DBGET integrated database retrieval system