KEGG   Escherichia coli K-12 MG1655: b1465Help
Entry
b1465             CDS       T00007                                 

Gene name
narV
Definition
(RefSeq) nitrate reductase 2 (NRZ), gamma subunit (EC:1.7.99.4)
  KO
K00374  
nitrate reductase gamma subunit [EC:1.7.5.1 1.7.99.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    b1465 (narV)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1465 (narV)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     b1465 (narV)
   1.7.99  With unknown physiological acceptors
    1.7.99.4  nitrate reductase
     b1465 (narV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1535937..1536617)
Genome map
AA seq 226 aa AA seqDB search
MIQYLNVFFYDIYPYICATVFFLGSWLRYDYGQYTWRASSSQMLDKRGMVIWSNLFHIGI
LGIFFGHLFGMLTPHWMYAWFLPVAAKQLMAMVLGGICGVLTLIGGAGLLWRRLTNQRVR
ATSTTPDIIIMSILLIQCLLGLSTIPFSAQYPDGSEMMKLVGWAQSIVTFRGGSSEMLNG
VAFVFRLHLVLGMTIFLLFPFTRLVHVWSAPFEYFTRRYQIVRSRR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgattcagtatctgaacgtctttttttacgatatctacccgtacatttgtgcgacggtg
tttttcctcggcagctggctgcgctacgactacgggcagtacacctggcgcgcctcctca
agtcaaatgctcgataaacgcgggatggtgatatggtcgaatctgttccatatcggcatt
ttggggattttcttcgggcacttgttcggcatgttaacgccgcactggatgtacgcgtgg
tttttgccagtggcagcgaaacaactcatggcgatggtgctcggcggtatttgcggtgtg
ttgacgttgattggcggcgcaggactgctgtggcgcaggctgacaaatcagcgcgtgcgt
gccacttccactacgccggatatcatcatcatgagcattttgctgatccagtgtctgttg
gggctaagtaccataccgttttcagcacagtatcctgatggtagcgaaatgatgaagctg
gtgggttgggcgcaaagcattgtcactttccgtggtggatcgtcagagatgctcaacggc
gtagcgttcgtcttccgcctgcatctggtgttgggaatgaccatcttcctgctcttcccg
ttcacccgactggtgcatgtgtggagcgcgccgtttgagtactttactcgtcgatatcaa
attgtgcgttcgcggcgataa

DBGET integrated database retrieval system