KEGG   Escherichia coli K-12 MG1655: b1469Help
Entry
b1469             CDS       T00007                                 

Gene name
narU
Definition
(RefSeq) nitrate/nitrite transporter
  KO
K02575  
MFS transporter, NNP family, nitrate/nitrite transporter
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    b1469 (narU)
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    b1469 (narU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1542672..1544060)
Genome map
AA seq 462 aa AA seqDB search
MALQNEKNSRYLLRDWKPENPAFWENKGKHIARRNLWISVSCLLLAFCVWMLFSAVTVNL
NKIGFNFTTDQLFLLTALPSVSGALLRVPYSFMVPIFGGRRWTVFSTAILIIPCVWLGIA
VQNPNTPFGIFIVIALLCGFAGANFASSMGNISFFFPKAKQGSALGINGGLGNLGVSVMQ
LVAPLVIFVPVFAFLGVNGVPQADGSVMSLANAAWIWVPLLAIATIAAWSGMNDIASSRA
SIADQLPVLQRLHLWLLSLLYLATFGSFIGFSAGFAMLAKTQFPDVNILRLAFFGPFIGA
IARSVGGAISDKFGGVRVTLINFIFMAIFSALLFLTLPGTGSGNFIAFYAVFMGLFLTAG
LGSGSTFQMIAVIFRQITIYRVKMKGGSDEQAHKEAVTETAAALGFISAIGAVGGFFIPQ
AFGMSLNMTGSPVGAMKVFLIFYIVCVLLTWLVYGRRKFSQK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcaaaatgagaaaaatagtcgttatcttttgcgcgactggaaaccagaaaat
ccggccttctgggaaaataaaggaaaacatattgctcgaagaaatctctggatatcagtc
agttgtctacttcttgccttctgtgtctggatgctatttagcgcagttaccgttaatctc
aataaaatcggttttaattttactaccgatcaactctttttattaaccgcattaccctcc
gtttctggcgcattattgcgtgttccctactcctttatggtgcctatattcggtggacgc
cgatggacggtttttagtactgcaatcctgattattccttgcgtctggctcggaattgcc
gtgcaaaatccgaatactccttttgggatatttatcgttatcgctttgctatgcggtttt
gcaggtgcaaactttgcttcgagcatgggcaatatcagtttcttctttccaaaagccaaa
caagggagcgctcttgggattaatggcggattaggaaacttaggtgtaagtgtaatgcag
ctggttgcaccgctggtcatttttgtacctgtatttgcctttctcggcgtcaatggcgta
ccgcaggccgacggttcggtgatgtcgctggcgaatgccgcatggatttgggtaccgcta
ctggcgattgccacgatcgccgcatggtcagggatgaatgatatcgccagttcacgcgcc
tcaattgccgaccagctccctgtcttacaacgcctgcatctctggctgctgagcctgctt
taccttgccaccttcggttcgtttatcggtttttctgcgggttttgccatgctggcaaaa
acccagttcccggatgtgaatattctgcgcctggcgttctttggcccatttatcggtgcc
atcgcgcggtcggttggtggtgctatttccgataagttcggcggcgtgcgggtgacgttg
atcaactttatttttatggcgattttcagtgccctgctgttccttaccttaccgggcaca
ggctccggtaatttcatcgccttttacgccgtatttatggggctgtttctgactgcgggt
ctgggaagtggttctactttccagatgatcgccgtcatctttcgccagataaccatttat
cgggtaaagatgaaaggcggtagtgatgagcaagctcataaagaagccgtcaccgaaacg
gcggcggctctgggctttatctcagccattggcgcagtgggcggcttttttattccgcag
gcgtttggcatgtcgctcaatatgaccggctctccggtcggcgcgatgaaagtgttttta
atcttctacatcgtttgtgtgctgctgacctggctggtttatggtcggcggaagttcagc
caaaaataa

DBGET integrated database retrieval system