KEGG   Escherichia coli K-12 MG1655: b1474Help
Entry
b1474             CDS       T00007                                 

Gene name
fdnG
Definition
(RefSeq) formate dehydrogenase-N, alpha subunit, nitrate-inducible (EC:1.2.1.2)
  KO
K08348  
formate dehydrogenase-N, alpha subunit [EC:1.1.5.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1474 (fdnG)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.6  formate dehydrogenase-N
     b1474 (fdnG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1547401..1550448
Genome map
AA seq 1015 aa AA seqDB search
MDVSRRQFFKICAGGMAGTTVAALGFAPKQALAQARNYKLLRAKEIRNTCTYCSVGCGLL
MYSLGDGAKNAREAIYHIEGDPDHPVSRGALCPKGAGLLDYVNSENRLRYPEYRAPGSDK
WQRISWEEAFSRIAKLMKADRDANFIEKNEQGVTVNRWLSTGMLCASGASNETGMLTQKF
ARSLGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANVVMVMGGNAAEAHPVG
FRWAMEAKNNNDATLIVVDPRFTRTASVADIYAPIRSGTDITFLSGVLRYLIENNKINAE
YVKHYTNASLLVRDDFAFEDGLFSGYDAEKRQYDKSSWNYQLDENGYAKRDETLTHPRCV
WNLLKEHVSRYTPDVVENICGTPKADFLKVCEVLASTSAPDRTTTFLYALGWTQHTVGAQ
NIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLGLLSTSLPGYLTLPSEKQVDLQS
YLEANTPKATLADQVNYWSNYPKFFVSLMKSFYGDAAQKENNWGYDWLPKWDQTYDVIKY
FNMMDEGKVTGYFCQGFNPVASFPDKNKVVSCLSKLKYMVVIDPLVTETSTFWQNHGESN
DVDPASIQTEVFRLPSTCFAEEDGSIANSGRWLQWHWKGQDAPGEARNDGEILAGIYHHL
RELYQSEGGKGVEPLMKMSWNYKQPHEPQSDEVAKENNGYALEDLYDANGVLIAKKGQLL
SSFAHLRDDGTTASSCWIYTGSWTEQGNQMANRDNSDPSGLGNTLGWAWAWPLNRRVLYN
RASADINGKPWDPKRMLIQWNGSKWTGNDIPDFGNAAPGTPTGPFIMQPEGMGRLFAINK
MAEGPFPEHYEPIETPLGTNPLHPNVVSNPVVRLYEQDALRMGKKEQFPYVGTTYRLTEH
FHTWTKHALLNAIAQPEQFVEISETLAAAKGINNGDRVTVSSKRGFIRAVAVVTRRLKPL
NVNGQQVETVGIPIHWGFEGVARKGYIANTLTPNVGDANSQTPEYKAFLVNIEKA
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcagtcgcagacaattttttaaaatctgcgcgggcggtatggctggaacaaca
gtagcggcattgggctttgccccgaagcaagcactggctcaggcgcgaaactacaaatta
ttacgcgctaaagagatccgtaacacctgcacatactgttccgtaggttgcgggctattg
atgtatagcctgggtgatggcgcaaaaaacgccagagaagcgatttatcacattgaaggt
gacccggatcatccggtaagccgtggtgcgctgtgcccgaaaggggccggtttgctggat
tacgtcaacagtgaaaaccgtctgcgctacccggaatatcgtgcgccaggttctgacaaa
tggcagcgcattagctgggaagaagcattctcccgtattgcgaagctgatgaaagctgac
cgtgacgctaactttattgaaaagaacgagcagggcgtaacggtaaaccgttggctttct
accggtatgctgtgtgcctccggtgccagcaacgaaaccgggatgctgacccagaaattt
gcccgctccctcgggatgctggcggtagacaaccaggcgcgcgtctgacacggaccaacg
gtagcaagtcttgctccaacatttggtcgcggtgcgatgaccaaccactgggtggatatc
aaaaacgctaacgtcgtgatggtgatgggcggtaacgctgctgaagcgcatcccgtcggt
ttccgctgggcgatggaagcgaaaaacaacaacgacgcaaccttgatcgttgtcgatccc
cgttttacgcgtaccgcttctgtggcggatatttacgcgcctattcgttccggtacggac
attacgttcctgtctggcgttttgcgctacctgatcgaaaacaacaaaatcaacgccgaa
tacgttaagcattacaccaacgccagcctgctggtgcgtgatgattttgctttcgaagac
ggtctgttcagcggctacgacgctgaaaaacgtcaatacgataaatcgtcctggaactat
cagctcgatgaaaacggctatgcgaaacgcgatgaaacactgactcatccgcgctgtgtg
tggaacctgctgaaagagcacgtttcccgctacacgccggacgtcgttgaaaacatctgc
ggtacgccaaaagccgacttcctgaaagtgtgtgaagtgctggcctccaccagcgcaccg
gatcgcacaaccaccttcctgtacgcgctgggctggacgcagcacactgtgggtgcgcag
aacatccgtactatggcgatgatccagttgctgctcggtaacatgggtatggccggtggc
ggcgtgaacgcattgcgtggtcactccaacattcagggcttgactgacttaggcctgctc
tctaccagcctgccaggttatctgacgctgccgtcagaaaaacaggttgatttgcagtcg
tatctggaagcgaacacgccgaaagcgacgctggctgatcaggtgaactactggagcaac
tatccgaagttcttcgttagcctgatgaaatctttctatggcgatgccgcgcagaaagag
aacaactggggctatgactggctgccgaagtgggaccagacctacgacgtcatcaagtat
ttcaacatgatggatgaaggcaaagtcaccggttatttctgccagggctttaacccggtt
gcgtccttcccggacaaaaacaaagtggtgagctgcctgagcaagctgaagtacatggtg
gttatcgatccgctggtgactgaaacctctaccttctggcagaaccacggtgagtcgaac
gatgtcgatccggcgtctattcagactgaagtattccgtctgccttcgacctgctttgct
gaagaagatggttctatcgctaactccggtcgctggttgcagtggcactggaaaggtcag
gacgcgccgggcgaagcgcgtaacgacggtgaaattctggcgggtatctaccatcatctg
cgcgagctgtaccagtccgaaggtggtaaaggcgtagaaccgctgatgaagatgagctgg
aactacaagcagccgcacgaaccgcaatctgacgaagtggctaaagagaacaacggctac
gcgctggaagatctctatgacgctaatggcgtgcttattgcgaagaaaggtcagttgctg
agtagctttgcgcatctgcgtgatgacggtacaaccgcatcttcttgctggatctacacc
ggtagctggacagagcagggcaaccagatggctaaccgcgataactccgacccgtccggt
ctggggaatacgctgggatgggcctgggcgtggccgctcaaccgtcgcgtgctgtacaac
cgtgcttcggcggatatcaacggtaaaccgtgggatccgaaacggatgctgatccagtgg
aacggcagcaagtggacgggtaacgatattcctgacttcggcaatgccgcaccgggtacg
ccaaccgggccgtttatcatgcagccggaagggatgggacgcctgtttgccatcaacaaa
atggcggaaggtccgttcccggaacactacgagccgattgaaacgccgctgggcactaac
ccgctgcatccgaacgtggtgtctaacccggttgttcgtctgtatgaacaagacgcgctg
cggatgggtaaaaaagagcagttcccgtatgtgggtacgacctatcgtctgaccgagcac
ttccacacctggaccaagcacgcattgctcaacgcaattgctcagccggaacagtttgtg
gaaatcagcgaaacgctggcggcggcgaaaggcattaataatggcgatcgtgtcactgtc
tccagcaagcgtggctttatccgcgcggtggctgtggtaacgcgtcgtctgaaaccgctg
aatgtaaatggtcagcaggttgaaacggtgggtattccaatccactggggctttgagggt
gtcgcgcgtaaaggttatatcgctaacactctgacgccgaatgtcggtgatgcaaactcg
caaacgccggaatataaagcgttcttagtcaacatcgagaaggcgtaa

DBGET integrated database retrieval system