KEGG   Escherichia coli K-12 MG1655: b1475Help
Entry
b1475             CDS       T00007                                 

Gene name
fdnH
Definition
(RefSeq) formate dehydrogenase-N, Fe-S (beta) subunit, nitrate-inducible
  KO
K08349  
formate dehydrogenase-N, beta subunit
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1475 (fdnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1550461..1551345
Genome map
AA seq 294 aa AA seqDB search
MAMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGL
PKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEEDHHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctatggaaacgcaggacattatcaaaaggtccgcaactaactccatcacgccgcct
tctcaggtgcgtgattacaaagcagaagtcgcaaaacttatcgacgtttccacctgtatc
ggctgtaaagcctgtcaggtggcgtgttcggagtggaacgacatccgtgatgaagtgggg
cactgcgtcggggtttacgataaccccgccgatctgagcgccaagtcctggacggtgatg
cgctttagcgaaaccgaacagaacggcaagctggagtggctgatccgtaaagacggctgt
atgcactgtgaagatcccggctgcctgaaggcgtgcccgtctgctggtgcaatcattcag
tacgctaacgggattgtcgatttccagtcggaaaactgcatcggctgtggttactgcatt
gccgggtgtccgtttaatattccgcgcctcaacaaagaggataaccgggtatataaatgc
acgctctgcgtcgatcgcgtcagcgtcggccaggaaccggcttgtgtgaaaacctgtccg
accggggctatccacttcggcaccaagaaggagatgctggagctggcggaacagcgcgtg
gcgaaactgaaagcgcgtggttacgaacatgctggcgtctacaacccggaaggggtcggt
ggtacgcacgttatgtacgtgctgcatcacgccgatcagccggagctgtatcacggtctg
ccgaaagatccgaagatcgacacctcggtaagcctgtggaaaggcgcgttgaaaccgctg
gcagcggctggctttattgccacttttgccgggttgattttccactacatcggtattggc
ccgaataaggaagtggacgatgacgaggaggatcatcatgagtaa

DBGET integrated database retrieval system