KEGG   Escherichia coli K-12 MG1655: b1476Help
Entry
b1476             CDS       T00007                                 

Gene name
fdnI
Definition
(RefSeq) formate dehydrogenase-N, cytochrome B556 (gamma) subunit, nitrate-inducible
  KO
K08350  
formate dehydrogenase-N, gamma subunit
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1476 (fdnI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1551338..1551991
Genome map
AA seq 217 aa AA seqDB search
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFF
GIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSI
MSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSI
KGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcgaaaatgattgtgcgcaccaaatttattgatcgcgcctgtcactggacc
gtggtgatttgcttcttcctggtggcgctgtccgggatttcgttcttcttcccgacgctg
caatggctgacgcaaaccttcggtacgccgcagatgggacgcattttgcacccgttcttc
ggcattgcgattttcgtcgcactgatgtttatgtttgtgcgttttgtgcatcacaacatc
ccggataagaaagatattccgtggctgttgaacattgtcgaagtattgaaaggcaatgag
cataaagtggcggatgtcggtaagtacaacgccgggcaaaagatgatgttctggtcgatc
atgagcatgattttcgtgctgctggtgaccggggtgattatctggcgtccgtactttgcg
cagtacttcccgatgcaggttgttcgctacagcctgctgatccacgcggctgcgggtatc
atcctgatccacgccatcctgatccatatgtatatggcattttgggtgaaaggatcgatt
aaagggatgatcgaagggaaggtaagtcgtcgctgggcgaagaaacaccatccgcgctgg
tatcgtgaaatcgagaaggcagaagcgaaaaaagagagtgaagaagggatataa

DBGET integrated database retrieval system