KEGG   Escherichia coli K-12 MG1655: b1479Help
Entry
b1479             CDS       T00007                                 

Gene name
maeA
Definition
(RefSeq) malate dehydrogenase, (decarboxylating, NAD-requiring) (malic enzyme) (EC:1.1.1.38)
  KO
K00027  
malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pyruvate metabolism
Carbon metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b1479 (maeA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    b1479 (maeA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1479 (maeA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     b1479 (maeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1553972..1555669)
Genome map
AA seq 565 aa AA seqDB search
MEPKTKKQRSLYIPYAGPVLLEFPLLNKGSAFSMEERRNFNLLGLLPEVVETIEEQAERA
WIQYQGFKTEIDKHIYLRNIQDTNETLFYRLVNNHLDEMMPVIYTPTVGAACERFSEIYR
RSRGVFISYQNRHNMDDILQNVPNHNIKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYT
ACGGISPAYTLPVVLDVGTNNQQLLNDPLYMGWRNPRITDDEYYEFVDEFIQAVKQRWPD
VLLQFEDFAQKNAMPLLNRYRNEICSFNDDIQGTAAVTVGTLIAASRAAGGQLSEKKIVF
LGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRFGLLTDKMPNLLPFQTKLVQKRE
NLSDWDTDSDVLSLLDVVRNVKPDILIGVSGQTGLFTEEIIREMHKHCPRPIVMPLSNPT
SRVEATPQDIIAWTEGNALVATGSPFNPVVWKDKIYPIAQCNNAFIFPGIGLGVIASGAS
RITDEMLMSASETLAQYSPLVLNGEGMVLPELKDIQKVSRAIAFAVGKMAQQQGVAVKTS
AEALQQAIDDNFWQAEYRDYRRTSI
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaaaaacaaaaaaacagcgttcgctttatatcccttacgctggccctgtactg
ctggaatttccgttgttgaataaaggcagtgccttcagcatggaagaacgccgtaacttc
aacctgctggggttactgccggaagtggtcgaaaccatcgaagaacaagcggaacgagca
tggatccagtatcagggattcaaaaccgaaatcgacaaacacatctacctgcgtaacatc
caggacactaacgaaaccctcttctaccgtctggtaaacaatcatcttgatgagatgatg
cctgttatttataccccaaccgtcggcgcagcctgtgagcgtttttctgagatctaccgc
cgttcacgcggcgtgtttatctcttaccagaaccggcacaatatggacgatattctgcaa
aacgtgccgaaccataatattaaagtgattgtggtgactgacggtgaacgcattctgggg
cttggtgaccagggcatcggcgggatgggcattccgatcggtaaactgtcgctctatacc
gcctgtggcggcatcagcccggcgtatacccttccggtggtgctggatgtcggaacgaac
aaccaacagctgcttaacgatccgctgtatatgggctggcgtaatccgcgtatcactgac
gacgaatactatgaattcgttgatgaatttatccaggctgtgaaacaacgctggccagac
gtgctgttgcagtttgaagactttgctcaaaaaaatgcgatgccgttacttaaccgctat
cgcaatgaaatttgttcttttaacgatgacattcagggcactgcggcggtaacagtcggc
acactgatcgcagcaagccgcgcggcaggtggtcagttaagcgagaaaaaaatcgtcttc
cttggcgcaggttcagcgggatgcggcattgccgaaatgatcatctcccagacccagcgc
gaaggattaagcgaggaagcggcgcggcagaaagtctttatggtcgatcgctttggcttg
ctgactgacaagatgccgaacctgctgcctttccagaccaaactggtgcagaagcgcgaa
aacctcagtgactgggataccgacagcgatgtgctgtcactgctggatgtggtgcgcaat
gtaaaaccagatattctgattggcgtctcaggacagaccgggctgtttacggaagagatc
atccgtgagatgcataaacactgtccgcgtccgatcgtgatgccgctgtctaacccgacg
tcacgcgtggaagccacaccgcaggacattatcgcctggaccgaaggtaacgcgctggtc
gccacgggcagcccgtttaatccagtggtatggaaagataaaatctaccctatcgcccag
tgtaacaacgcctttattttcccgggcatcggcctgggtgttattgcttccggcgcgtca
cgtatcaccgatgagatgctgatgtcggcaagtgaaacgctggcgcagtattcaccattg
gtgctgaacggcgaaggtatggtactgccggaactgaaagatattcagaaagtctcccgc
gcaattgcgtttgcggttggcaaaatggcgcagcagcaaggcgtggcggtgaaaacctct
gccgaagccctgcaacaggccattgacgataatttctggcaagccgaataccgcgactac
cgccgtacctccatctaa

DBGET integrated database retrieval system