KEGG   Escherichia coli K-12 MG1655: b1481Help
Entry
b1481             CDS       T00007                                 

Gene name
bdm
Definition
(RefSeq) biofilm-dependent modulation protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1556065..1556280)
Genome map
AA seq 71 aa AA seqDB search
MFTYYQAENSTAEPALVNAIEQGLRAQHGVVTEDDILMELTKWVEASDNDILSDIYQQTI
NYVVSGQHPTL
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgtttacttattatcaggcagaaaattcaacagcagaacccgctctggttaatgccatt
gagcaaggccttcgggcacagcatggtgttgtcactgaagatgacattctcatggagctg
accaaatgggttgaagcttctgataacgacatcctcagtgatatctaccagcaaacgatc
aattatgtggtcagtggccagcaccctacgctttaa

DBGET integrated database retrieval system