KEGG   Escherichia coli K-12 MG1655: b1484Help
Entry
b1484             CDS       T00007                                 

Gene name
ddpD
Definition
(RefSeq) D,D-dipeptide permease system, ATP-binding component
  KO
K02031  
peptide/nickel transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Peptides/nickel transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    b1484 (ddpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1558031..1559017)
Genome map
AA seq 328 aa AA seqDB search
MTQPVLDIQQLHLSFPGFNGDVHALNNVSLQINRGEIVGLVGESGSGKSVTAMLIMRLLP
TGSYCVHRGQISLLGEDVLNAREKQLRQWRGARVAMIFQEPMTALNPTRRIGLQMMDVIR
HHQPISRREARAKAIDLLEEMQIPDAVEVMSRYPFELSGGMRQRVMIALAFSCEPQLIIA
DEPTTALDVTVQLQVLRLLKHKARASGTAVLFISHDMAVVSQLCDSVYVMYAGSVIESGV
TADVIHHPRHPYTIGLLQCAPEHGVPRQLLPAIPGTVPNLTHLPDGCAFRDRCYAAGAQC
ENVPALTACGDNNQRCACWYPQQEVISV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacccgttctggacattcaacaactgcatttgagtttccccggttttaacggt
gatgttcacgcgctcaacaatgtgtccttgcagattaaccgcggtgaaattgtcggtctg
gtgggagaatccggctcaggtaaatcagtcaccgcaatgctgattatgcgtctgctaccg
acgggcagttattgcgtacatcgggggcagatttccctgctgggagaagatgttcttaac
gcgcgggaaaaacagcttcgtcagtggcgcggcgcacgagtggcgatgatctttcaggaa
ccgatgaccgccctcaatccgacacgtcgaataggtcttcagatgatggacgtgatccgc
catcatcaaccaataagtcgtcgggaagccagagctaaagcgattgacctgctggaagag
atgcaaatcccggatgccgtggaagttatgtcgcgctatccgtttgagctttcaggtggt
atgcgccagcgggtaatgattgcgctggcattctcctgcgagccgcaattgattattgcc
gacgaaccgactacggcgctggacgtcacggtgcagttgcaggtactgcgtttgcttaaa
cataaagcccgcgccagtggaactgcggttctgttcatcagccatgatatggccgtggtg
tcgcaactgtgcgatagcgtttacgtgatgtatgccggaagcgtaattgaaagcggcgtg
acggcagacgttatccatcatccccggcatccgtataccattggtttgctgcaatgcgca
ccagaacatggagtaccacgccagctattacccgccattccagggacggtaccaaacctc
acccatttgcctgacggctgcgcttttcgcgatcgttgctatgcggcaggtgcacagtgt
gaaaacgtcccggcgctgacagcgtgtggtgacaacaaccagcgctgtgcctgttggtat
ccgcagcaggaggttataagtgtctga

DBGET integrated database retrieval system