KEGG   Escherichia coli K-12 MG1655: b1486Help
Entry
b1486             CDS       T00007                                 

Gene name
ddpB
Definition
(RefSeq) D-ala-D-ala transporter subunit
  KO
K02033  
peptide/nickel transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Peptides/nickel transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    b1486 (ddpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1559907..1560929)
Genome map
AA seq 340 aa AA seqDB search
MTFWSILRQRCWGLVLVVAGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLD
QPLYVQFYRYVSDLFHGDLGTSIRTGRPVLEELRIFFPATLELAFGALLLALLIGIPLGI
LSAVWRNRWLDHLVRIMAITGISTPAFWLGLGVIVLFYGHLQILPGGGRLDDWLDPPTHV
TGFYLLDALLEGNGEVFFNALQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTAR
ASGLPGWYIVLCYALPNALIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQAL
DFPAVMGFAVVVSFAYVLVNLVVDLLYLWIDPRIGRGGGE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttctggagtattttacgccaacgctgctgggggctggtgctcgtggtggcgggc
gtctgcgtgattacgtttattatctcgcatctgatccctggtgatccggcgcggttactg
gcgggtgaccgcgccagcgatgctatcgtggaaaatattcgccagcaactgggactggac
cagccactgtatgtacagttttaccgctacgtcagcgacctgtttcatggtgacctggga
acatccattcgtaccgggcgtccggtgctggaagagttgcgtatatttttcccggcgacg
ctggagctggcttttggtgccctgctgctggcactcctgattggcatcccgctgggcata
ctctctgcagtctggcgaaatcgctggctggatcatctggtgcgaataatggccattacc
ggaatctccacacctgcgttctggcttgggctgggcgtcattgtgctgttttatggtcat
ctgcaaattcttcccggcggcggaaggcttgatgactggctggatccaccaacgcacgtt
accggcttttatctgctcgatgcgctgcttgaaggcaacggtgaagtcttcttcaatgcg
ttgcaacatctcatcttaccggcattaacgctggcgttcgttcacctgggaattgtcgct
cgccagatccgctcagcgatgctggaacaattgagtgaagactacattcgtaccgcccgg
gccagcggcttgcccggctggtatatcgttttatgttatgcgctacccaatgcgttgatc
ccatcgattaccgtattgggtttggcgctgggcgatttgttgtatggcgcagtgctcacc
gaaaccgtttttgcctggcccggaatgggtgcatgggtagtaacatcaatacaggcgctc
gacttcccggcagtgatgggctttgccgtcgtggtttcatttgcttatgtgctggtcaac
ctggtggtggatttgctctatttgtggattgatccgcgtatcggacgtggaggtggtgaa
tga

DBGET integrated database retrieval system