KEGG   Escherichia coli K-12 MG1655: b1488Help
Entry
b1488             CDS       T00007                                 

Gene name
ddpX
Definition
(RefSeq) D-ala-D-ala dipeptidase, Zn-dependent (EC:3.4.13.-)
  KO
K08641  
D-alanyl-D-alanine dipeptidase [EC:3.4.13.22]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Vancomycin resistance
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1488 (ddpX)
 Human Diseases
  Antimicrobial resistance
   01502 Vancomycin resistance
    b1488 (ddpX)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.22  D-Ala-D-Ala dipeptidase
     b1488 (ddpX)
Peptidases [BR:eco01002]
 Metallo Peptidases
  Family M15: zinc D-Ala-D-Ala carboxypeptidase family
   b1488 (ddpX)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  Vancomycin resistance modules
   Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]
    b1488 (ddpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1562495..1563076)
Genome map
AA seq 193 aa AA seqDB search
MSDTTELVDLAVIFPDLEIELKYACADNITGKAIYQQARCLLHKDAITALAKSISIAQLS
GLQLVIYDAYRPQQAQAMLWQACPDPQYVVDVTVGSNHSRGTAIDLTLRDEHGNILDMGA
GFDEMHERSHAYHPSVPPAAQRNRLLLNAIMTGGGFVGISSEWWHFELPQAASYPLLADQ
FSCFISPGTQHVS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataccaccgaactggttgatttagccgtaatcttccctgatctggagatcgaa
ttgaaatacgcctgcgctgataacatcacaggtaaagctatttatcagcaagcgcgttgt
ctgttacacaaggatgcgattaccgcgctggcgaaaagtatcagcatcgcccagctgtca
gggttacaactggtgatttacgatgcgtatcgcccacaacaagcacaggcgatgttgtgg
caagcctgcccagacccgcaatatgttgttgatgtgacggtcggttctaatcacagccgt
ggcacggcgatcgacctgacgcttcgtgatgagcacgggaacatcctcgatatgggcgca
gggttcgatgaaatgcacgagcgctcccatgcctatcacccttccgtcccgcccgccgct
cagcgcaatcggctgttgctgaatgcgataatgactggtggcggttttgtcggtatctcc
agcgaatggtggcacttcgaattaccccaggcagcgagttaccctctgctcgctgatcaa
ttctcttgttttatatcccctggcacacagcacgtcagttaa

DBGET integrated database retrieval system