KEGG   Escherichia coli K-12 MG1655: b1533Help
Entry
b1533             CDS       T00007                                 

Gene name
eamA
Definition
(RefSeq) cysteine and O-acetyl-L-serine efflux system
  KO
K15268  
O-acetylserine/cysteine efflux transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1533 (eamA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1620238..1621137)
Genome map
AA seq 299 aa AA seqDB search
MSRKDGVLALLVVVVWGLNFVVIKVGLHNMPPLMLAGLRFMLVAFPAIFFVARPKVPLNL
LLGYGLTISFAQFAFLFCAINFGMPAGLASLVLQAQAFFTIMLGAFTFGERLHGKQLAGI
ALAIFGVLVLIEDSLNGQHVAMLGFMLTLAAAFSWACGNIFNKKIMSHSTRPAVMSLVIW
SALIPIIPFFVASLILDGSATMIHSLVTIDMTTILSLMYLAFVATIVGYGIWGTLLGRYE
TWRVAPLSLLVPVVGLASAALLLDERLTGLQFLGAVLIMTGLYINVFGLRWRKAVKVGS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaaaagatggggtgttggcgctactggtagtggtcgtatgggggctaaatttt
gtggtcatcaaagtggggcttcataacatgccaccgctgatgctggccggtttgcgcttt
atgctggtcgcttttccggctatcttttttgtcgcacgaccgaaagtaccactgaatttg
ctgctggggtatggattaaccatcagttttgcgcagtttgcttttcttttttgtgccatt
aacttcggtatgcctgctggactggcttcgctggtgttacaggcacaggcgttttttact
atcatgcttggcgcgtttactttcggggagcgactgcatggcaaacaattggcggggatc
gccttagcgatttttggcgtactggtgttaatcgaagatagtctgaacggtcagcatgtg
gcgatgctcggctttatgttgaccctggcggcagcatttagttgggcgtgtggcaacatc
ttcaataaaaagatcatgtcgcactcaacgcgtccggcggtgatgtcgctggtaatctgg
agcgctttaatcccaatcattcccttctttgttgcctcgctgattctcgatggttccgca
accatgattcacagtctggttactatcgatatgaccaccatcttgtctctgatgtatctg
gcgtttgtggcgacaattgttggttatgggatctgggggacgttactgggacgctatgaa
acctggcgggttgcaccgttatcgttactggtgcccgtagtaggactggcaagtgcggca
ctattgttggatgaacgcttaacgggtctgcaatttttaggtgcggtgctcattatgacc
gggctgtatatcaatgtatttggcttgcggtggcgtaaagcggtaaaggtgggaagttaa

DBGET integrated database retrieval system