KEGG   Escherichia coli K-12 MG1655: b1554Help
Entry
b1554             CDS       T00007                                 

Gene name
rrrQ
Definition
Qin prophage; putative lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     b1554 (rrrQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1639524..1640057)
Genome map
AA seq 177 aa AA seqDB search
MNTKIRYGLSAAVLALIGAGASAPQILDQFLDEKEGNHTMAYRDGSGIWTICRGATVVDG
KTVFPNMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgctggc
gcatctgctcctcagatacttgaccagtttctggacgaaaaagaaggtaaccacacaatg
gcataccgcgatggttctggcatatggaccatctgtcggggtgccacagtggtggatgga
aaaaccgtttttcccaatatgaaactgtcgaaggaaaaatgcgaccaggtcaacgccatt
gagcgtgataaggcgctggcatgggtggagcgcaatattaaagtaccactgaccgaacca
caaaaagcgggtatcgcgtcattttgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgctggtgatcgtaaaggtgcatgcgaagcgattcgc
tggtggattaaggatggcggacgcgattgccgcattcgttcaaataactgttacggtcag
gttattcgtcgtgaccaggagagcgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system