KEGG   Escherichia coli K-12 MG1655: b1558Help
Entry
b1558             CDS       T00007                                 

Gene name
cspF
Definition
(RefSeq) Qin prophage; cold shock protein
  KO
K03704  
cold shock protein (beta-ribbon, CspA family)
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Other transcription factors
   Others
    b1558 (cspF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1641855..1642067
Genome map
AA seq 70 aa AA seqDB search
MSRKMTGIVKTFDGKSGKGLITPSDGRIDVQLHVSALNLRDAEEITTGLRVEFCRINGLR
GPSAANVYLS
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccgtaaaatgacaggaattgtcaaaacctttgacggcaaaagcggcaagggtctt
atcaccccatccgatggtcgtatcgatgtccagcttcatgtttcagcgctcaatctccgc
gatgcagaagaaattaccaccggattacgcgtggaattttgccggataaatggtctgcgt
ggcccttcagctgccaatgtttacctttcatga

DBGET integrated database retrieval system