KEGG   Escherichia coli K-12 MG1655: b1561Help
Entry
b1561             CDS       T00007                                 

Gene name
rem
Definition
(RefSeq) Qin prophage; uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1644651..1644902)
Genome map
AA seq 83 aa AA seqDB search
MMNIEELRKIFCEDGLYAVCVENGNLVSHYRIMCLRKNGAALINFVDARVTDGFILREGE
FVTSLQALKEIGIKAGFSAFSGE
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacatcgaagaactgcgtaaaattttttgtgaagatggcctctatgctgtgtgc
gttgaaaatggaaatcttgttagtcattaccgcattatgtgtttgcgaaagaatggggct
gcgttaattaattttgtggatgctcgggtcacggacggatttatcttgcgcgaaggtgag
tttgtcacttcattacaggcattgaaagagatcggaataaaagctggcttttctgctttt
tcaggagaataa

DBGET integrated database retrieval system