KEGG   Escherichia coli K-12 MG1655: b1563Help
Entry
b1563             CDS       T00007                                 

Gene name
relE
Definition
(RefSeq) Qin prophage; toxin of the RelE-RelB toxin-antitoxin system
  KO
K06218  
mRNA interferase RelE/StbE
Organism
eco  Escherichia coli K-12 MG1655
Brite
Prokaryotic defense system [BR:eco02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   RelE/StbE-RelB/StbD
    b1563 (relE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1645346..1645633)
Genome map
AA seq 95 aa AA seqDB search
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGY
RLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattttctggattttgacgagcgggcactaaaggaatggcgaaagctgggctcg
acggtacgtgaacagttgaaaaagaagctggttgaagtacttgagtcaccccggattgaa
gcaaacaagctccgtggtatgcctgattgttacaagattaagctccggtcttcaggctat
cgccttgtataccaggttatagacgagaaagttgtcgttttcgtgatttctgttgggaaa
agagaacgctcggaagtatatagcgaggcggtcaaacgcattctctga

DBGET integrated database retrieval system