KEGG   Escherichia coli K-12 MG1655: b1565Help
Entry
b1565             CDS       T00007                                 

Gene name
ydfV
Definition
(RefSeq) Qin prophage; uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1645897..1646202
Genome map
AA seq 101 aa AA seqDB search
MSLQVSHYNMLRASHEGSQKVVVRTVITVRFVPGAAIAKSILYCAGQLVFKESGHHLTGT
DTIYFVTVRLHMHNSTYSSIFCFSMSVLLSRRRVSGDLTCR
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtcattacaagtatcgcactacaacatgcttagggcaagtcacgaaggaagtcagaaa
gtagtcgtaagaacggtgatcactgtccgctttgtgccaggagcagccattgctaagtcc
atcctgtattgtgcaggtcagctcgtttttaaagagtccggccatcatcttactggtaca
gacaccatatactttgtgacggtcaggctacatatgcacaactcaacttattcatctatt
ttttgctttagcatgtcagtgttgctttctcgtcggcgggtgagcggtgacctgacctgt
cgataa

DBGET integrated database retrieval system