KEGG   Escherichia coli K-12 MG1655: b1566Help
Entry
b1566             CDS       T00007                                 

Gene name
flxA
Definition
(RefSeq) Qin prophage; uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1646405..1646737
Genome map
AA seq 110 aa AA seqDB search
MSVTIQGNTSTVISNNSAPEGTSEIAKITRQIQVLTEKLGKISSEEGMTTQQKKEMAALV
QKQIESLWAQLEQLLRQQAEKKNEDATVQPDKKEEKKDDTNTAGTIDIYV
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcacaattcagggaaatacctcaaccgttatttcaaacaactccgccccggaa
ggaacatcagaaatagccaaaatcacaagacaaattcaggtgctgactgaaaagcttggg
aaaatctcatcggaagaggggatgacgacacagcagaaaaaagaaatggctgcattggta
cagaagcaaattgaaagcctctgggctcaactggagcagttgttaaggcagcaggcagag
aaaaagaatgaagacgcgacagttcagcctgataaaaaagaagagaaaaaagacgataca
aataccgctggcaccattgatatttacgtctaa

DBGET integrated database retrieval system