KEGG   Escherichia coli K-12 MG1655: b1582Help
Entry
b1582             CDS       T00007                                 

Gene name
ynfA
Definition
(RefSeq) UPF0060 family inner membrane protein
  KO
K09771  
small multidrug resistance family-3 protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1582 (ynfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1655347..1655673)
Genome map
AA seq 108 aa AA seqDB search
MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY
AAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacaacgttactattttttgctactgcgctgtgtgaaattattggatgcttt
ctgccctggttgtggttaaaacgaaacgccagtatctggctgttgcttccggcggggatt
tcactggcgctgtttgtctggttgttaacgttgcatccagcggcgagtgggcgtgtttac
gcggcttatggtggcgtttatgtctgcacggcgttgatgtggctgcgcgttgtggatggc
gtgaaactgactctttatgactggacgggtgcgttgattgcgctttgcggcatgttgatc
attgttgcgggctgggggcgcacgtag

DBGET integrated database retrieval system