KEGG   Escherichia coli K-12 MG1655: b1593Help
Entry
b1593             CDS       T00007                                 

Gene name
ynfK
Definition
(RefSeq) putative dethiobiotin synthetase
  KO
K01935  
dethiobiotin synthetase [EC:6.3.3.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    b1593 (ynfK)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     b1593 (ynfK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1666524..1667219)
Genome map
AA seq 231 aa AA seqDB search
MLKRFFITGTDTSVGKTVVSRALLQALASQGKTVAGYKPVAKGSKETPEGLRNKDALVLQ
SVSTIELPYEAVNPIALSEEESSVAHSCPINYTLISNGLANLTEKVDHVVVEGTGGWRSL
MNDLRPLSEWVVQEQLPVLMVVGIQEGCINHALLTAQAIANDGLPLIGWVANRINPGLAH
YAEIIDVLGKKLPAPLIGELPYLPRAEQRELGQYIRLAMLRSVLAVDRVTV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgtttctttattaccggtacagacacttctgtagggaaaacggtggtttcc
cgcgcattgctacaagcgttagcctcccagggaaaaacggttgcgggatataaacccgta
gcgaaggggagcaaagagacacccgaagggctgcgtaataaagatgccctggtgttgcag
agtgtttcaaccatcgaactgccttatgaagcagttaatcctatcgcgttaagcgaagaa
gaaagtagcgtggcgcacagttgcccaatcaattacaccctcatttcaaacggcctggca
aacctgaccgaaaaagtcgatcatgtcgtggtagaagggactggcggctggcgcagtctg
atgaatgatttgcgtccactctctgaatgggtagtgcaggaacaactgccggtgttgatg
gttgtcggtattcaggaaggttgcattaaccatgcactgctaacagctcaggcgatcgcc
aacgacgggctgccgctcattggctgggtggctaaccgaatcaacccaggactggcgcat
tatgcggaaatcattgatgtgctgggtaaaaaacttccggcaccgctcattggtgaactg
ccttatctgccgcgcgccgaacagcgtgaactggggcaatacatccgcttagctatgctg
cgcagtgtgctggcggtagatagagtcacggtgtaa

DBGET integrated database retrieval system