KEGG   Escherichia coli K-12 MG1655: b1596Help
Entry
b1596             CDS       T00007                                 

Gene name
ynfM
Definition
(RefSeq) putative arabinose efflux transporter
  KO
K08224  
MFS transporter, YNFM family, putative membrane transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Acriflavin-sensitivity (YnfM) family [TC:2.A.1.36]
    b1596 (ynfM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1669699..1670952
Genome map
AA seq 417 aa AA seqDB search
MSRTTTVDGAPASDTDKQSISQPNQFIKRGTPQFMRVTLALFSAGLATFALLYCVQPILP
VLSQEFGLTPANSSISLSISTAMLAIGLLFTGPLSDAIGRKPVMVTALLLASICTLLSTM
MTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLIS
GVFTDFFNWRIALAAIGCFALASALMFWKILPESRHFRPTSLRPKTLFINFRLHWRDRGL
PLLFAEGFLLMGSFVTLFNYIGYRLMLSPWHVSQAVVGLLSLAYLTGTWSSPKAGTMTTR
YGRGPVMLFSTGVMLFGLLMTLFSSLWLIFAGMLLFSAGFFAAHSVASSWIGPRAKRAKG
QASSLYLFSYYLGSSIAGTLGGVFWHNYGWNGVGAFIALMLVIALLVGTRLHRRLHA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtactacaactgttgatggcgctccggcaagcgacactgacaagcaaagcatt
tctcagccaaatcaatttattaaacgcggtacgccgcaatttatgcgcgtcaccctggcg
ctgttctctgccggactggcaacatttgcacttctctattgtgtgcagcctatccttccg
gtgctttcgcaggagtttggcttaacccccgcgaacagtagtatttcactgtccatttcc
acggcgatgttggctattggtttgctgtttactggcccgctatccgatgccattggtcgc
aaaccagtgatggtcacggcgctactgttggcctccatttgtacgttactttcgacaatg
atgaccagctggcacggcattttgattatgcgcgccttgattgggctttcgttaagtggc
gtggcagctgttggcatgacttatcttagcgaggaaatccatcccagtttcgtggccttt
tcaatggggttgtatatcagcggcaactcaattggcggcatgagcggacgcttaattagc
ggtgtcttcacggactttttcaactggcgaattgctctggcggcaatcggttgtttcgcg
ctggcctcggcgttgatgttctggaaaatcctccctgaatcacgccattttcgcccgact
tcgctgcgccctaagacgttgtttatcaactttcgtctgcactggcgtgaccggggatta
ccgttattgttcgcagaaggctttttgctgatggggtcgttcgtcacgctgtttaattac
atcggctatcggttgatgctctccccctggcatgtcagtcaggccgtggttggcttatta
tcgctggcttatttgaccggtacatggagctcacccaaagccggaaccatgaccacccgc
tatgggcgtggtccagtgatgttgttttcgacgggggttatgctgtttggtttactgatg
accttattcagctcgctgtggctgatctttgccggaatgttactcttctcagcaggattc
ttcgcagcccactcagtagccagcagctggatcggcccccgcgcaaaacgcgctaaaggc
caggcctcctcgctgtatctgttcagttactatctggggtcgagtattgccgggacgctg
ggtggtgttttctggcataactatggctggaacggcgtcggcgcatttattgctctgatg
ctggtcattgctctgctggtcgggacgcgtttgcatcgtcgtctgcacgcctga

DBGET integrated database retrieval system