KEGG   Escherichia coli K-12 MG1655: b1599Help
Entry
b1599             CDS       T00007                                 

Gene name
mdtI
Definition
(RefSeq) multidrug efflux system transporter
  KO
K11742  
spermidine export protein MdtI
Organism
eco  Escherichia coli K-12 MG1655
Module
Multidrug resistance, efflux pump MdtIJ
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1599 (mdtI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1672820..1673149)
Genome map
AA seq 109 aa AA seqDB search
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID
LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtttgaatgggttcacgccgcctggctggcattggcaatcgtgctggaaatc
gttgctaacgtctttttgaaattttctgacggctttcgtcgcaaaatatttggcttgctc
tccctggcggcggtgctggctgcctttagtgcgctttctcaagccgttaaagggatcgac
ttgtctgtcgcttatgcattgtggggcgggtttggtattgccgccacgttagccgcaggt
tggatcttgtttggtcaacggttaaatcgtaaaggctggattggcctggtcttgctgttg
gctggaatgatcatggtgaaacttgcctga

DBGET integrated database retrieval system