KEGG   Escherichia coli K-12 MG1655: b1603Help
Entry
b1603             CDS       T00007                                 

Gene name
pntA
Definition
(RefSeq) pyridine nucleotide transhydrogenase, alpha subunit (EC:1.6.1.2)
  KO
K00324  
NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    b1603 (pntA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     b1603 (pntA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1676371..1677903)
Genome map
AA seq 510 aa AA seqDB search
MRIGIPRERLTNETRVAATPKTVEQLLKLGFTVAVESGAGQLASFDDKAFVQAGAEIVEG
NSVWQSEIILKVNAPLDDEIALLNPGTTLVSFIWPAQNPELMQKLAERNVTVMAMDSVPR
ISRAQSLDALSSMANIAGYRAIVEAAHEFGRFFTGQITAAGKVPPAKVMVIGAGVAGLAA
IGAANSLGAIVRAFDTRPEVKEQVQSMGAEFLELDFKEEAGSGDGYAKVMSDAFIKAEME
LFAAQAKEVDIIVTTALIPGKPAPKLITREMVDSMKAGSVIVDLAAQNGGNCEYTVPGEI
FTTENGVKVIGYTDLPGRLPTQSSQLYGTNLVNLLKLLCKEKDGNITVDFDDVVIRGVTV
IRAGEITWPAPPIQVSAQPQAAQKAAPEVKTEEKCTCSPWRKYALMALAIILFGWMASVA
PKEFLGHFTVFALACVVGYYVVWNVSHALHTPLMSVTNAISGIIVVGALLQIGQGGWVSF
LSFIAVLIASINIFGGFTVTQRMLKMFRKN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattggcataccaagagaacggttaaccaatgaaacccgtgttgcagcaacgcca
aaaacagtggaacagctgctgaaactgggttttaccgtcgcggtagagagcggcgcgggt
caactggcaagttttgacgataaagcgtttgtgcaagcgggcgctgaaattgtagaaggg
aatagcgtctggcagtcagagatcattctgaaggtcaatgcgccgttagatgatgaaatt
gcgttactgaatcctgggacaacgctggtgagttttatctggcctgcgcagaatccggaa
ttaatgcaaaaacttgcggaacgtaacgtgaccgtgatggcgatggactctgtgccgcgt
atctcacgcgcacaatcgctggacgcactaagctcgatggcgaacatcgccggttatcgc
gccattgttgaagcggcacatgaatttgggcgcttctttaccgggcaaattactgcggcc
gggaaagtgccaccggcaaaagtgatggtgattggtgcgggtgttgcaggtctggccgcc
attggcgcagcaaacagtctcggcgcgattgtgcgtgcattcgacacccgcccggaagtg
aaagaacaagttcaaagtatgggcgcggaattcctcgagctggattttaaagaggaagct
ggcagcggcgatggctatgccaaagtgatgtcggacgcgttcatcaaagcggaaatggaa
ctctttgccgcccaggcaaaagaggtcgatatcattgtcaccaccgcgcttattccaggc
aaaccagcgccgaagctaattacccgtgaaatggttgactccatgaaggcgggcagtgtg
attgtcgacctggcagcccaaaacggcggcaactgtgaatacaccgtgccgggtgaaatc
ttcactacggaaaatggtgtcaaagtgattggttataccgatcttccgggccgtctgccg
acgcaatcctcacagctttacggcacaaacctcgttaatctgctgaaactgttgtgcaaa
gagaaagacggcaatatcactgttgattttgatgatgtggtgattcgcggcgtgaccgtg
atccgtgcgggcgaaattacctggccggcaccgccgattcaggtatcagctcagccgcag
gcggcacaaaaagcggcaccggaagtgaaaactgaggaaaaatgtacctgctcaccgtgg
cgtaaatacgcgttgatggcgctggcaatcattctttttggctggatggcaagcgttgcg
ccgaaagaattccttgggcacttcaccgttttcgcgctggcctgcgttgtcggttattac
gtggtgtggaatgtatcgcacgcgctgcatacaccgttgatgtcggtcaccaacgcgatt
tcagggattattgttgtcggagcactgttgcagattggccagggcggctgggttagcttc
cttagttttatcgcggtgcttatagccagcattaatattttcggtggcttcaccgtgact
cagcgcatgctgaaaatgttccgcaaaaattaa

DBGET integrated database retrieval system