KEGG   Escherichia coli K-12 MG1655: b1615Help
Entry
b1615             CDS       T00007                                 

Gene name
uidC
Definition
(RefSeq) putative outer membrane porin for beta-glucuronides porin protein
  KO
K16140  
putative glucuronide porin
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b1615 (uidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1691586..1692851)
Genome map
AA seq 421 aa AA seqDB search
MRKIVAMAVICLTAASGLTSAYAAQLADDEAGLRIRLKNELRRADKPSAGAGRDIYAWVQ
GGLLDFNSGYYSNIIGVEGGAYYVYKLGARADMSTRWYLDGDKSFGFALGAVKIKPSENS
LLKLGRFGTDYSYGSLPYRIPLMAGSSQRTLPTVSEGALGYWALTPNIDLWGMWRSRVFL
WTDSTTGIRDEGVYNSQTGKYDKHRARSFLAASWHDDTSRYSLGASVQKDVSNQIQSILE
KSIPLDPNYTLKGELLGFYAQLEGLSRNTSQPNETALVSGQLTWNAPWGSVFGSGGYLRH
AMNGAVVDTDIGYPFSLSLDRNREGMQSWQLGVNYRLTPQFTLTFAPIVTRGYESSKRDV
RIEGTGILGGMNYRVSEGPLQGMNFFLAADKGREKRDGSTLGDRLNYWDVKMSIQYDFML
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagtggccatggccgttatttgcctgacggctgcctctggccttacctct
gcttatgcggcgcaactggctgacgatgaagcgggactacgcatcagactgaaaaacgaa
ttgcgcagggcggataagcccagtgctggcgcgggaagagatatttacgcatgggtacag
ggaggattgctcgatttcaatagtggttattattccaatattattggcgttgaaggcggg
gcgtattatgtttataaattaggtgctcgtgctgatatgagtacccggtggtatcttgat
ggtgataaaagttttggctttgccctgggggcagtaaaaataaaacccagtgaaaatagc
ctgcttaaattaggtcgcttcgggacggattatagttatggtagcttaccttatcgtatt
ccgttaatggctggcagttcgcaacgtacattaccgacagtttctgaaggagcattaggt
tattgggctttaacaccaaatattgatctgtggggaatgtggcgttcacgagtattttta
tggactgattcaacaaccggtattcgtgatgaaggggtgtataacagccagacgggaaaa
tacgataaacatcgcgcacgttcttttttagccgccagttggcatgatgataccagtcgc
tattctctgggggcatcggtacagaaagatgtttccaatcagatacaaagtattctcgag
aaaagcataccgctcgacccgaattatacgttgaaaggggagttgctcggcttttacgcg
cagctcgaaggtttaagtcgtaataccagccagcccaatgaaacggcgttggttagtgga
caattgacctggaatgcgccgtggggaagtgtatttggcagtggtggttatttgcgccat
gcaatgaatggtgccgtggtggataccgacattggctatcccttttcattaagtcttgat
cgtaaccgtgaaggaatgcagtcctggcaattgggcgtcaactatcgtttaacgccgcaa
tttacgctgacatttgcaccgattgtgactcgcggctatgaatccagtaaacgagatgtg
cggattgaaggcacgggtatcttaggtggtatgaactatcgggtcagcgaagggccgtta
caagggatgaatttctttcttgctgccgataaagggcgggaaaagcgcgatggcagtacg
ctgggcgatcgcctgaattactgggatgtgaaaatgagtattcagtatgactttatgctg
aagtaa

DBGET integrated database retrieval system