KEGG   Escherichia coli K-12 MG1655: b1628Help
Entry
b1628             CDS       T00007                                 

Gene name
rsxB
Definition
(RefSeq) SoxR iron-sulfur cluster reduction factor component; putative iron-sulfur protein
  KO
K03616  
electron transport complex protein RnfB
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1706348..1706926
Genome map
AA seq 192 aa AA seqDB search
MNAIWIAVAAVSLLGLAFGAILGYASRRFAVEDDPVVEKIDEILPQSQCGQCGYPGCRPY
AEAISCNGEKINRCAPGGEAVMLKIAELLNVEPQPLDGEAQEITPARMVAVIDENNCIGC
TKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPDSWKWDLNT
IPVRIIPVEHHA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctatctggattgccgttgccgccgtgagcctgctgggcctggcgtttggcgcc
attctgggttatgcctcccgccgttttgcggtggaagacgatccggtcgttgagaaaatt
gacgaaatcttaccgcagagccagtgtggtcagtgcggttatcccggctgtcgcccctac
gcggaagccatcagctgtaacggtgaaaaaatcaaccgttgcgccccaggtggcgaagct
gtgatgctaaaaattgccgagttgcttaatgtcgagccgcagccgctggatggcgaagcg
caagagataacgcctgcgcggatggtggcggttattgatgaaaataactgtattggctgc
actaaatgtattcaggcgtgtccggtagacgccatcgttggcgctacccgtgccatgcat
acggtaatgagtgatctctgtacgggctgcaatttatgtgttgatccgtgcccgacgcac
tgcatctcgttgcaaccggtcgcagaaacacctgactcctggaaatgggatctgaacacc
attcccgtgcgtatcattcccgtggaacaccatgcttaa

DBGET integrated database retrieval system