KEGG   Escherichia coli K-12 MG1655: b1630Help
Entry
b1630             CDS       T00007                                 

Gene name
rsxD
Definition
(RefSeq) SoxR iron-sulfur cluster reduction factor component; putative membrane protein of electron transport complex
  KO
K03614  
electron transport complex protein RnfD
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1709142..1710200
Genome map
AA seq 352 aa AA seqDB search
MVFRIASSPYTHNQRQTSRIMLLVLLAAVPGIAAQLWFFGWGTLVQILLASVSALLAEAL
VLKLRKQSVAATLKDNSALLTGLLLAVSIPPLAPWWMVVLGTVFAVIIAKQLYGGLGQNP
FNPAMIGYVVLLISFPVQMTSWLPPHEIAVNIPGFIDAIQVIFSGHTASGGDMNTLRLGI
DGISQATPLDTFKTSVRAGHSVEQIMQYPIYSGILAGAGWQWVNLAWLAGGVWLLWQKAI
RWHIPLSFLVTLALCAMLGWLFSPETLAAPQIHLLSGATMLGAFFILTDPVTASTTNRGR
LIFGALAGLLVWLIRSFGGYPDGVAFAVLLANITVPLIDYYTRPRVYGHRKG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtattcagaatagctagctccccttatacccataaccagcgccagacatcgcgcatt
atgctgttggtgttgctcgcagccgtgccaggaatcgcagcgcaactgtggttttttggt
tggggtactctcgttcagatcctgttggcatcggttagtgctctgttagccgaagctctc
gtactcaaactacgcaagcagtcggtagccgcaacgttgaaagataactcagcattgctg
acaggcttattgctggcggtaagtattccccccctcgcgccatggtggatggtcgtgctg
ggtacggtgtttgcggtgatcatcgctaaacagttgtatggcggtctgggacaaaacccg
tttaatccggcaatgattggttatgtggtcttactgatctccttccccgtgcagatgacc
agctggttaccgccacatgaaattgcggtcaacatccctggttttatcgacgccatccag
gttatttttagcggtcataccgccagtggtggtgatatgaacacactacgcttaggtatt
gatggcattagtcaggcgacaccgctggatacatttaaaacctctgtccgtgccggtcat
tcggttgaacagattatgcaatatccgatctacagcggtattctggcgggcgctggttgg
caatgggtaaatctcgcctggctggctggcggcgtatggttgctatggcagaaagcgatt
cgctggcatattcccctcagcttcttagtaacgctggcgttatgcgcaatgttgggctgg
ttgttctcaccagaaacactggcagcaccgcaaattcatctgctgtctggagcgaccatg
ctcggcgcattctttattttgactgacccggttaccgcttctacgaccaatcgtggtcgt
cttattttcggcgcgcttgcgggcttattagtctggttgatccgcagtttcggcggctat
cctgacggcgtggcttttgccgtcctgctggcgaacatcacggttcctctgatcgattac
tacacgcgtccgcgcgtctacggccatcgcaaagggtaa

DBGET integrated database retrieval system