KEGG   Escherichia coli K-12 MG1655: b1632Help
Entry
b1632             CDS       T00007                                 

Gene name
rsxE
Definition
(RefSeq) SoxR iron-sulfur cluster reduction factor component; electron transport inner membrane NADH-quinone reductase
  KO
K03613  
electron transport complex protein RnfE
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1710828..1711523
Genome map
AA seq 231 aa AA seqDB search
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR
HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA
KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD
SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaattaaagacgttattgttcaggggttgtggaaaaacaactctgcgctggtc
cagttgctcggcctttgtcctctgttggcggtcacgtccactgccactaacgctctgggt
ttaggacttgcgactacgctggtactgacgctgaccaacctgaccatttcgacgctgcgt
cactggacgccagccgagatccgcattcccatttacgtgatgatcatcgcctcggtggtc
agcgctgtacagatgctgatcaacgcctacgcctttggcctgtatcaatcattagggatt
tttattccgctgattgtcactaactgtatcgttgtgggccgcgctgaagccttcgccgcc
aaaaaaggtccggcgctttcggcactggacggcttttcaattggtatgggcgcaacctgc
gccatgttcgtgctgggttcactacgcgaaattatcggcaatggcacattgtttgacggt
gcagatgcgctgttaggtagctgggcaaaagtattacgcgtggagattttccacaccgac
tcccctttcctgctggcgatgctgccaccaggtgcatttattggcctgggactgatgctg
gcaggaaaatacctgattgatgaaagaatgaaaaagcgccgtgctgaagcagctgcagaa
cgtgcattgccaaacggtgaaacagggaatgtctga

DBGET integrated database retrieval system