KEGG   Escherichia coli K-12 MG1655: b1634Help
Entry
b1634             CDS       T00007                                 

Gene name
dtpA
Definition
(RefSeq) dipeptide and tripeptide permease A
  KO
K03305  
proton-dependent oligopeptide transporter, POT family
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ASAP: 
UniProt: 
Position
1712769..1714271
Genome map
AA seq 500 aa AA seqDB search
MSTANQKPTESVSLNAFKQPKAFYLIFSIELWERFGYYGLQGIMAVYLVKQLGMSEADSI
TLFSSFSALVYGLVAIGGWLGDKVLGTKRVIMLGAIVLAIGYALVAWSGHDAGIVYMGMA
AIAVGNGLFKANPSSLLSTCYEKNDPRLDGAFTMYYMSVNIGSFFSMIATPWLAAKYGWS
VAFALSVVGLLITIVNFAFCQRWVKQYGSKPDFEPINYRNLLLTIIGVVALIAIATWLLH
NQEVARMALGVVAFGIVVIFGKEAFAMKGAARRKMIVAFILMLEAIIFFVLYSQMPTSLN
FFAIRNVEHSILGLAVEPEQYQALNPFWIIIGSPILAAIYNKMGDTLPMPTKFAIGMVMC
SGAFLILPLGAKFASDAGIVSVSWLVASYGLQSIGELMISGLGLAMVAQLVPQRLMGFIM
GSWFLTTAGANLIGGYVAGMMAVPDNVTDPLMSLEVYGRVFLQIGVATAVIAVLMLLTAP
KLHRMTQDDAADKAAKAAVA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgtccactgcaaaccaaaaaccaactgaaagcgtcagtttgaacgctttcaaacaaccg
aaggcgttctatctcatcttctcgattgagttatgggaacgttttggttattacggccta
caaggaattatggctgtttacctggttaaacaactgggtatgtctgaagcggattcaatc
acccttttctcttcctttagtgccctggtttatggtctggtcgctatcggcggctggtta
ggtgacaaggtactgggtactaaacgcgtaattatgctcggcgctattgtgctggcgatt
ggttatgctctggttgcctggtctggtcacgacgccggtatcgtttatatgggtatggcg
gctattgcggtcggtaacggcctgtttaaagctaacccgtcttctctgctttctacatgc
tatgagaaaaacgacccgcgtctggacggtgcattcaccatgtactacatgtccgtcaac
atcggctctttcttctctatgattgctacgccgtggctggccgcgaaatacggctggagt
gttgcgtttgcgttgagcgttgtaggcctgctgatcactatcgttaacttcgccttctgc
caacgctgggttaaacagtacggttcaaaaccagacttcgagcctatcaactaccgtaac
ctgctgctgaccattattggtgttgtggcactgatcgctatcgccacctggctgctgcac
aatcaggaagttgcgcgtatggcgctgggcgttgttgccttcggtatcgtggttatcttc
ggtaaagaagccttcgcgatgaaaggtgctgcgcgtcgtaaaatgatcgttgccttcatc
ctgatgctcgaagccattatcttcttcgtgctgtacagccagatgccaacgtcactgaac
ttctttgcgattcgtaacgttgagcactccattctgggtctggccgtagaacctgagcag
tatcaggcactgaacccgttctggatcatcatcggtagtccgattctggccgctatctat
aacaagatgggcgataccctgccgatgccaaccaagtttgcaatcggcatggtgatgtgt
tctggtgcgttcctgattctgccgctgggtgcgaaattcgcgtctgacgctggtatcgtg
tctgtaagctggctggtcgcaagctatggcctgcagagcatcggggaactgatgatctct
ggtctgggtctggcaatggttgctcaactcgttccgcagcgtctgatgggcttcattatg
ggtagctggttcctgaccactgccggtgcaaacctgattggtggttatgttgcgggtatg
atggctgtgccggataacgttaccgatccgctgatgtcactggaagtctatggtcgcgta
ttcttgcagattggtgtcgctactgccgttattgcagtactgatgctgctgaccgcgccg
aaactgcaccgcatgacgcaggatgacgctgcagacaaagcggcgaaagcagccgtagcg
taa

DBGET integrated database retrieval system