KEGG   Escherichia coli K-12 MG1655: b1650Help
Entry
b1650             CDS       T00007                                 

Gene name
nemA
Definition
(RefSeq) chromate reductase, quinone reductase, FMN-linked; N-Ethylmaleimide reductase; old yellow enzyme (EC:1.-.-.-)
  KO
K10680  
N-ethylmaleimide reductase [EC:1.-.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    b1650 (nemA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     b1650 (nemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1726659..1727756
Genome map
AA seq 365 aa AA seqDB search
MSSEKLYSPLKVGAITAANRIFMAPLTRLRSIEPGDIPTPLMAEYYRQRASAGLIISEAT
QISAQAKGYAGAPGIHSPEQIAAWKKITAGVHAENGHMAVQLWHTGRISHASLQPGGQAP
VAPSALSAGTRTSLRDENGQAIRVETSMPRALELEEIPGIVNDFRQAIANAREAGFDLVE
LHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAGIEEWGADRIGIRVSPIGT
FQNTDNGPNEEADALYLIEQLGKRGIAYLHMSEPDWAGGEPYTDAFREKVRARFHGPIIG
AGAYTVEKAETLIGKGLIDAVAFGRDWIANPDLVARLQRKAELNPQRAESFYGGGAEGYT
DYPTL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgaaaaactgtattccccactgaaagtgggcgcgatcacggcggcaaaccgt
atttttatggcaccgctgacgcgtctgcgcagtattgaaccgggtgacattcctaccccg
ttgatggcggaatactatcgccaacgtgccagtgccggtttgattattagtgaagccacg
caaatttctgcccaggcaaaaggatatgcaggtgcgcctggcatccatagtccggagcaa
attgccgcatggaaaaaaatcaccgctggcgttcatgctgaaaatggtcatatggccgtg
cagctgtggcacaccggacgcatttctcacgccagcctgcaacctggcggtcaggcaccg
gtagcgccttcagcacttagcgcgggaacacgtacttctctgcgcgatgaaaatggtcag
gcgatccgtgttgaaacatccatgccgcgtgcgcttgaactggaagagattccaggtatc
gtcaatgatttccgtcaggccattgctaacgcgcgtgaagccggttttgatctggtagag
ctccactctgctcacggttatttgctgcatcagttcctttctccttcttcaaaccatcgt
accgatcagtacggcggcagcgtggaaaatcgcgcacgtttggtactggaagtggtcgat
gccgggattgaagaatggggtgccgatcgcattggcattcgcgtttcaccaatcggtact
ttccagaacacagataacggcccgaatgaagaagccgatgcactgtatctgattgaacaa
ctgggtaaacgcggcattgcttatctgcatatgtcagaaccagattgggcggggggtgaa
ccgtatactgatgcgttccgcgaaaaagtacgcgcccgtttccacggtccgattatcggc
gcaggtgcatacacagtagaaaaagctgaaacgctgatcggcaaagggttaattgatgcg
gtggcatttggtcgtgactggattgcgaacccggatctggtcgcccgcttgcagcgcaaa
gctgagcttaacccacagcgtgccgaaagtttctacggtggcggcgcggaaggctatacc
gattacccgacgttgtaa

DBGET integrated database retrieval system